Pages : 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067

  1. Spellbound Dvd Region 1 Ntsc Sleeve 352289476613
  2. Peugeot 205 VAN 11 Box 53bhp Front Brake 283180600417
  3. Punk Disney Alice In Wonderland Rebel Tattoo Vest 302865040442
  4. New Womens Plus Size Zip Peplum Frill Blazer 600832489494
  5. Nine In The Afternoon by Panic at the 163442026547
  6. 30Pcs 45cm Super Soft Sponge Red Balls Close Up 202481955424
  7. Cybex Platinum Priam Rahmen Kinderwagen All Terrain inkl 372541022902
  8. VW Passat 97 00 20 4motion EST 118 Front 132872508001
  9. Wrist Corsage Bracelet Bridesmaid Sisters Hand Flowers Wedding 521886953628
  10. One United Club One Time Pass exp May 153266767872
  11. Camo Camouflage Tarpaulin Tarp 27M X 35M Waterproof 231802266885
  12. 1 8 Air Compressor Pressure Relief Valve Regulator Safety 273202612214
  13. 20gm Xmas RED GOLD SILVER GREEN Mix Luxury 292788627977
  14. Ladies Running Trainers Womens Fitness Gym Light Sports 690703156089
  15. ZF Rear Sprocket 40T 520P ZFD 897 40 GLD Dual Gold 401586370857
  16. Men Comme des Garcons 2 Eau de Parfum 392195044556
  17. Royal Doulton Polar Bear Canada Limited Edition Figurine 143065354585
  18. Quills 27X40 Ds Movie Poster One Sheet New 182531868907
  19. Fuel Tap Repair Rebuild Kit Fits Kawasaki VULCAN 263674783307
  20. ALLOY WHEEL MAK MILANO 8x17 5x1143 ET40 BLACK 382603874827
  21. Lego Pirates of the Caribbean The video game 233044030921
  22. New Genuine MEYLE Tie Track Rod End 37 16 401512991074
  23. Job Lot of 8 Vintage White West Highland 202540779531
  24. Nabic DN25 FIG 542 Inlet Safety Steam Valve 273583341721
  25. 72 Honda Cb350F Four Clutch Friction Fiber Fibre 400863236157
  26. chelsea v bate uefa europa league press kit 302969990918
  27. Vintage Antique Woodwork Chisel Gouge Robtsorby Ghbuck Ward 332973636209
  28. 9 PCE Sports Carnaby Blue Black Car 264074502611
  29. New Volvo XC60 24 D Genuine Delphi 9 292269755078
  30. Alfa Romeo 33 239 C5W Green Interior Glove 292233100618
  31. Ferodo DS3000 Rear Brake Pads for BMW 3 323376478325
  32. 12 Cell Battery for TOSHIBA Satellite C655 S5340C655 S5342C655 S5343C660 125 382533536168
  33. 7 Pin Din Midi Cable Foot Switch to 161082666304
  34. 80GE 1500W Car DC 12V to AC 240V 252388286712
  35. Adults Mens Plain Thermal Fingerless Knitted Winter Warm 471727358009
  36. Bailey 716 Pressure Safety Relief Valve Full Lift 283052704652
  37. Best Micro Android iPhone Lightning USB Charging Data 461579067295
  38. Marvel Legends ToysRUs Exclusive Evolution of GROOT Guardians 264091149056
  39. Honda CBR 1000 RA9 Fireblade C ABS 2009 Semi 262086325255
  40. Poppy Cats Dream by Jones Lara Hardback Book 142911906892
  41. Corgi 1 50 Scale AN14001 Volvo FH General 132893156615
  42. Armstrong Rear GG Brake Pad Yamaha TZR 125 331871272746
  43. Ducati 750 SS Supersport 1992 520SXHD X Ring Gold 142884608982
  44. Personalised Canvas Print A1 A2 A3 A4 560433354875
  45. S Gel Wave Tough Shockproof Phone Case Gel Cover 572680861246
  46. ATV 2006 Yamaha YFM 50 Raptor RMSTATOR Two 332586240485
  47. Les Pecheurs de Perles by Dervaux CD 163399546969
  48. Dinky Dan Toys 042 Renault R8 Gordini Driver 264098071815
  49. 1 8 Air Compressor Pressure Relief Valve Regulator Safety 283132199384
  50. GB 2006 Anniv of Victoria Cross Set Mint 292852551834
  51. Secret Agent 1936 05 Film A3 Box Canvas 292743651514
  52. x3 Crusadia Leonis CYHO EN008 Common Yu Gi Oh Card English 223081198007
  53. Gemondo Sterling Silver Peridot Marcasite Art Nouveau 183517158233
  54. Red Piping 1 1 SQ Stitching Quilted Seat Covers 153219695968
  55. Immortals DVD 2012 Mickey Rourke 143062645443
  56. Old wooden double pulley 192727181500
  57. 24 CH NVR24CH 1080P8CH 5MP16CH 3MP IP Camera 331712447395
  58. Sterling Silver 925 Earring Ear Ball Fish Hook 441031922946
  59. Yamaha YZF R 125 EFI 2009 Silkolene Comp 4 131720646697
  60. Trax Black Grey Car Seat Covers Cover For 323512584454
  61. GARY NUMAN Old OG Vtg 70 80s Button Pin 273129540700
  62. 10 30 Loose Glitter Tubes Kids Card Making Scrapbooks 690372031584
  63. Handmade silk on silk authentic Turkish rug hanging 202500348043
  64. Ford Transit Tddi 2006 2012 Single Heavy Duty Black 183237155677
  65. Michelin Pilot Power 2CT Rear Tyre 160 60 ZR17 151434986134
  66. Smoothies by Eliq Maranik English Hardcover Book Free 263698485392
  67. steel wheels VW LT 281 363 205 55 R16 91V 132244486965
  68. Fork Oil Seals Kawasaki GPZ 600 R ZX600A1 401559842591
  69. Piston Kit For PiaggioFor Gilera STD 125cc 2 142626089171
  70. OPTICAL TOP MINT SMC PENTAX A 645 45mm F 28 254035548639
  71. BLACK RED W8mm SHOULDER NECK STRAP FOR SLR 312369798831
  72. Job Lot Of 4 Mobile Phones%C2%A0NokiaLGSamsung Sony 382663022661
  73. For HP Pavilion 15 A Series LCD Back Cover Red 192588560031
  74. Stormzy Poster A4 A3 A3 SIZES 542013739702
  75. Heatrae Sadia Megaflo Temperature Pressure Valve Insulation 302982915730
  76. Rocker Cover Gasket Set FOR MERCEDES W204 18 401611628881
  77. New Altronics 720p WiFi IP IR Cloud 183581958717
  78. PS4 Slim Console Spiderman Skin Decal Vinal Sticker 132869011678
  79. 112 Dollhouse Miniature Wood Double Door Can Be 273160069840
  80. TRX 300 FWK 1989 Putoline DX 4 10w40 261264339837
  81. New Womens Zip Smart Ankle Boots Ladies Mid 521902252044
  82. steel wheels CITROEN C3 S 195 55 R16 87T 273604714284
  83. Vintage Art Deco Bakelite Catalin Bird Pointed Brown 123525607433
  84. UK Womens Winter Hoodies Oversized Pullover Tops Ladies 512609358550
  85. Boy Girl 21st Age 21 Birthday 522015602886
  86. Betrayal at House on the Hill Board 392194698763
  87. Yamaha XV 1600 A Wild Star Road Star 110925448375
  88. West Ham United 1977 78 253606324847
  89. Picture Postcard London Buckingham Palace East Front 292871135733
  90. EBC Rear Contour Brake Disc For Kawasaki 2007 371879962292
  91. The Book of War 25 Centuries of Great 382651560856
  92. Women 100 Real Suede Leather Tassel Velet Warm 631636503258
  93. Solomon Islands Flag Silver Cufflinks Tie Clip Box 253632842370
  94. Patsy Cline The Absolutely Essential 3Cd Collection 152753513892
  95. Sexy Ladies Atmosphere Blue Swimsuit Size 8 382505609461
  96. 1984 Honda VF700 VF 700 C V45 Magna 361965928817
  97. PC 9NB Lian Li PC 9NB Essence Series Midi Tower Case 323580454781
  98. Suzuki Rg 500 1986 500 Cc Ignition 390945468443
  99. JMT Gold X Ring Drive Chain 520 P 273539891572
  100. Aluminium Engine Kit Suzuki GSX1300R Hayabusa 12 Orange 321575307331
  101. Mens T Shirt Cotton Long Sleeved Brave Soul Prague 232605460024
  102. For Chevrolet Tacuma Daewoo Lanos Nubira 16 18 173340152505
  103. The Kings Jaunt George IV in Scotland 1822 123517558683
  104. 451460 Winderosa Carburetor Kit Pwc 192746883447
  105. 1 x Small Pillow Pack Jewellery Gift Pouch 171174061043
  106. SMU6012 STARTER SOLENOID KAWASAKI ZX1100 2000 1052cc 272821570400
  107. Maxxis 180 55 17 ZR Supermaxx Sport Rear Yamaha YZF 322494169497
  108. Universal 3D Carbon Fiber Look Car Side Skirt 123490730405
  109. Gpr Hom Ghisa Evo 2 Kit Exhaust Honda Hornet 112775779774
  110. PULP Disco 2000 French 1995 Island limited 362516249877
  111. Single Mass Flywheel Conversion Clutch Kit For Vw 264039865439
  112. 2017 18 LEEDS UNITED v SHEFFIELD WEDNESDAY 113158998375
  113. MEDION AKOYA P6620 Replacement Laptop Adapter 90W AC 322327902997
  114. haynes manual ford escort orion sept 113491278332
  115. OE Mahle Alternator Z1660 14V 80A IA1008 AAK5311 362073227505
  116. 2007 Vauxhall Astra 17 Cdti Sri 100 Only 153303461829
  117. The History of South Africa by Roger B 263806111547
  118. 4Pcs Parrot Bebop Blade Propeller Mounting Install for 223133184726
  119. Classic 3D Textured Black Carbon Fiber Film Vinyl 452986104374
  120. sony playstation classic console New Sealed 223269526541
  121. New Toshiba Satellite L750 0CN Laptop Screen 156 LED 323293375141
  122. 2006 FORD GT Electrical Wiring Diagram Service Shop 161009936516
  123. Triumph Daytona 750 1992 NGK Iridium Spark Plugs 360939782589
  124. 1x Bosch Phase Sensor 0232101026 3165142610696 362210878147
  125. Tin of Vintage Buttons assorted colours and sizes 233037365415
  126. 22mm NATO %C2%AE Smart Watch strap nylon PVD 171628324263
  127. Mink DeVille %E2%80%8E%E2%80%93 Coup De Gr%C3%A2ce 392011885100
  128. Vaillant Ecotec Plus 612 615 618 624 630 541495657143
  129. Toyota Fortuner car stereo adapter Connect your Steering 431555500890
  130. GLP073 BOSCH GLOW PLUG VW Vento 19 TDI 153194918072
  131. Fluid Mechanics Valve Co 1700 Safety Relief Vavle PN 312369070806
  132. Beautiful Dollshouse Dolls House Miniature MEDIUM Woven Turkish 183585948473
  133. Car SUV Headlight Light Lens Restoration Repair Headlamp 192521313048
  134. Vespa LML Px125 150 200 Clutch And Brake 323610963708
  135. Suzuki GSX 1100 ES Half Fairing Black Blue 113375612210
  136. Skinny Baby Mans Mens Slim Plain High Quality 492189934930
  137. Royal Doulton Large Falstaff Toby Character Jug D 153295633205
  138. The Scottish Mountaineering Club Journal 2018 9781907233098 Hardback 302996364554
  139. UK Layout Black Frame Black Keyboard For Toshiba 202314800787
  140. Fawlty Towers The Complete Collection DVD 2005 John 273559822492
  141. Blue Floral Cold Shoulder Top By George 332841796535
  142. Kerr Modern Tartan Brushwool Scarf Tie Gift 323286907846
  143. The Spirit of Modern Philosophy Paperback Josiah Royce 392111569074
  144. Sun Hydraulic Pilot Operated Relief Valve RPECLCN 323590608959
  145. 00038554 Classic Cantabile TROMBA Bb Jazz trumpet 282516152679
  146. 266LB Natural smokey quartz obelisk crystal wand point 153300229214
  147. Cavo Gas Honda Crf 450 R 2009 2016 172404183215
  148. EP 10928891 Internal Hard Disk 1000 GB 25 173672221368
  149. Replacement Front Exhaust Y Pipe for Mitsubishi Shogun 263075550637
  150. Jazz Soundtracks by Gerry Mulligan CD 163398394562
  151. Pr Di Rossetto 11 Bar Pressure Relief Valve 332427980953
  152. Clayton Kershaw Signed Rawlings MLB Baseball Autograph Dodgers 323616349423
  153. Antique Hallmarked Sterling Silver Pocket Watch 1894 Thos 372547961546
  154. Elipse P3 Half Mask Respirator 182331637810
  155. OIL FILTER OIL Oil FILTER HONDA TRX FA 153125038057
  156. Pour Alcatel PoP 4 OT7070 7070X Ecran Tactile 162253475916
  157. VW Caddy 10 20 TDI Estate 108bhp Front 132872341706
  158. XS PAIR Hair BARRETTE Stained GLASS Black Ebony 173618978500
  159. Naval Cover 1971 Uss 660 5 Lance 362517788594
  160. nabic fig 500T DN32 pressure and temperature relief 332627245024
  161. After the Storm 202404881883
  162. steel wheels VW Derby 86C 205 55 R16 91V 273606560195
  163. 32 Hooks Jewelry Keyring Display Rotating Iron 1 Tier 591595324709
  164. Polisport ignition cover protector black 8460800001 263767412285
  165. 3in1 Black Quilt Pet Seat Cover Dog Protector 123363371949
  166. Wallace and Gromit in Project Zoo Sony Playstation 173704082675
  167. ROCKMELONS All I Want Is You used CD single CDS ships 251407046401
  168. Nintendo 64 N64 Diddy Kong Racing Boxed PAL 453083863749
  169. 1945 Pol Roger Champagne illustrated Lucius Beebe text 312297599011
  170. 1 8 Air Compressor Pressure Relief Valve Regulator Safety 332931055766
  171. Fantasy Village Original ACEO watercolour by David 254032508607
  172. Blu Ray RIDING THE BULLET 2004 David Arquette Stephen 332492389984
  173. i TO FIT A SKODA SUPERB CAR 391635185733
  174. 2012 12 Volkswagen Polo 14 85ps 332909504649
  175. Replacement Remote Control for Blaupunkt 32 147I WB 5B HKUP 162767810166
  176. BRAKE CABLE for Giantco Lambros 50 DT 4T 271827518111
  177. Van Gogh Dormitory In The Hospital In Arles 372546135250
  178. A ROYAL ALBERT 5 Bud Vase in the 153281492272
  179. Battery for HP Pavilion 15 P015AX 15 P015NF 15 P015NK 15 P015NS 182934924330
  180. The Secret Origin of Tony Stark Book 3 282971040847
  181. Kids Box Level 1 Pupils Book British English 263758490955
  182. Clear Samsung Galaxy Note 8 Friendly Case 3D 202247694918
  183. New Genuine LuK Clutch Kit 624 3109 09 202293967056
  184. New Hp Pavilion Dm1 1200Sv Laptop Screen 116 Led 330716164785
  185. Queen Elizabeth II 1966 HALFPENNY Brilliant uncirculated 323564072413
  186. Trini Alvarado Signed Autograph and Headshot Photo 192740128815
  187. Brake Disc TRW Lucas Floating For Suzuki DL 123505648030
  188. African Wooden Stunning Hand Carved 71 2%E2%80%9D Long 273612288454
  189. THUNDERPANTS Rupert Grint Stephen Fry Paul Giamatti DVD 362507589326
  190. SNAP TITE INC SAV60 T6P 15A Sequence Valve No Check 163443456798
  191. Electric Bass Guitar Strap W 3 Pick Holders Leather 271948553441
  192. WALKERT BONE The Essential T Bone Walker Co US IMPORT CD 113428788709
  193. 4 x ENERGIZER AAA 800mAh RECHARGEABLE BATTERIES PRE CHARGED 163375247781
  194. A House is not a Home without A 283301723730
  195. Nike AIR ZOOM PEGASUS 34 UK 7 EU 202547821424
  196. 14 02 1995 Fulham v Northampton Town Item 372536555475
  197. Echo Street Here Now CD RP US IMPORT CD NEW 113318528351
  198. Let It Snow 20 Christmas Family Favourites Various 113491398986
  199. Kids Funny RC Smart Robot Dinosaur Toy Remote 541979521376
  200. Mesh Headrest Travel Dog Guard Barrier Grill For 273512981864
  201. Westlife Westlife The Lovesongs Cd Pop 2014 New 371843071630
  202. PARKER HYDRAULIC Shuttle Valve CS101B 10 size 112145178911
  203. Wheel Nuts Locks 12 4 12x15 Bolts for 182342680753
  204. Shrek Forever After The Final Chapter 2010 291905168979
  205. CITROEN C3 10 ON Black Red Piping Front Pair 142962248356
  206. Genuine Vauxhall Zafira B O S RH Headlamp 93190409 222004602501
  207. Nidoqueen REV HOLO 69 160 XY Primal Clash 132889448474
  208. Martin MSP7100 Phosphor Bronze Lifespan Coated Acoustic Strings 141288284993
  209. Laptop DC Adapter Car Charger USB for 323259850066
  210. Oscar Peterson Duke Ellington Sarah Vaughan Ger 163406632597
  211. Mrs Browns Boys Dmovie 2014 Brand New Sealed 161948928302
  212. BMW K 1200 R S GT 143012126293
  213. Women Asymmetrical Hem Halter Lace Crochet Dress Sexy 453021201036
  214. OXO Softworks Good Grips Egg Beater Whipped Cream 183578688901
  215. VW Golf MK5 2004 2009 Hatchback Right 123429908083
  216. CNC Long Brake Clutch Levers For KTM 390 182852370706
  217. Ruitertassen Teacher Bag Leather Unisex School Bag 2 362484451381
  218. DZ09 Smart Watch Phone Camera Bluetooth Apple 401555725404
  219. 4FT Upgraded LED Batten Tube Wall Ceiling Light 323410290017
  220. Electric USB Automatic Fly Killer Pest Control Catcher 610848439862
  221. IRIN B103 Silver Bass Strings 4 String Set 223252319645
  222. Ducati Monster S4 916cc 2002 CC 390488711532
  223. Mens Leather Two Tone Formal Office Smart 152946623237
  224. Waterproof Pet Dog Boot Mat Liner Protector For 123409066633
  225. Adhesive Backed Neoprene Sponge foam Rubber Sheet Various Sizes 563178533605
  226. Classical Chinese Aubusson Design 100 Wool Rug Runner 462131137432
  227. SINNIS STEALTH 125 Oxford Trapezium Motorcycle Mirror Glass 332565490412
  228. Post Motor HEPA Washable Ball Vacuum Cleaner For 113441405146
  229. Kawasaki ZXR400 2000 2003 WRP Front Wheel 282619205958
  230. VINYL LP RECORD BEETHOVEN Pastoral Symphony No 323599875217
  231. Sweet Party Lace Princess Dress for 18 American 492077222154
  232. 12 x 00 Gauge Hornby Bachmann Collett Corridor 122128749211
  233. EBC Front Brake Disc VR Aprilia Rally 50 302505587588
  234. Boys Girls Kids Official Licensed Disney Various Winter 413604726370
  235. HONDA PCX 125 2010 Exide Lithium Li Ion Battery 292226756931
  236. New Sealed in Box Samsung Galaxy Note 5 563344394378
  237. CLANNADHARRYS GAMEVG EX2 Track 7 Single Picture SleeveRCA RECORDS 113444961292
  238. 2 4 6 8 10x MG996R Metal Gear Torque Digital Servo For 461513661624
  239. Black White Less To Do Quote Drinks Mat 173332144389
  240. Wooden Pretend Magnet Fruits Vegetables Kitchen Food Cutting 651171973902
  241. Brake Discs Brake Pads Front Ventilated %C3%98310 371968591691
  242. Punk Surfer Totally Awesome Light Brown Coco Bead 222308987728
  243. Yamaha YP 250 R X Max 2014 Reusable Oil 131731946573
  244. Koganei S250 Pneumatic Shuttle Valve Aluminum with 3 173598994423
  245. Luxury Ultra Thin Leather Flip Wallet Case Cover 413181937827
  246. V RIBBED BELTS DAYCO 6PK1415 For CHRYSLER FORD MERCEDES BENZ 112756599294
  247. Mens TITANIUM Magnetic Bracelet Chrome 32 Strong Magnets 251138954719
  248. Color Pick GBM Supplies Office Students Metal ball 173615907776
  249. ALLOY WHEEL MAK VOLARE 75x17 5x112 ET42 BLACK 362309240953
  250. iPhone 7 Plus Case Terf Leather Flip 690312156377
  251. Yamaguchi Red Venom Spiderman Marvel Carnage Action Figure 283237306593
  252. Red Mist Blu ray 162883358244
  253. 4x steel wheels FORD Tourneo Connect PH2 185 60 153300419268
  254. Mascot Tight Shut Off Valve 253995962337
  255. Queen Greatest Hits New CD Album 303008499201
  256. EBC Redstuff Rear Brake Pads for Nissan Aus NZ 122944511212
  257. BLUE PRINT Clutch slave cylinders ADS73604 292800141218
  258. KILEN 25100 FOR VW PASSAT Hatch FWD Front 391923696641
  259. Diney Blu Ray Bundle 51 blu rays 264098217148
  260. High Quality Rubber Lined Zinc Plated Steel P 431133737010
  261. Vauxhall Cavaliere Convertible All Models Van Seat Cover 122557729639
  262. VINTAGE Hardback BOOK THE COLOURFUL STORY OF 163451942781
  263. Set of 2 Alkaline Button Cells AG2 100 292355937522
  264. Quilted Front Seat Covers Protectors For FORD PUMA 273253960720
  265. Brass Craft Dual Outlet Stop Valve CR3901L R1 332898326360
  266. Fit Moto Guzzi V7 Racer 11 12 13 362272857772
  267. 02036 Trumpeter Workable Track for US T8SE1 Track 173613859922
  268. I Am Legend BLU RAY 153268992659
  269. 12V Submersible Fuel Water Oil Liquid Pump Stainless 352553484686
  270. Posture Corrector Adjustable Clavicle Back Support Brace For 153137531125
  271. 014 036 0012 MEYLE Breather hose fit BMW 201992758208
  272. 2 X Black TN2320 Toner Cartridge for Brother 391814197781
  273. Strong Double Wall Base Lid ACOUSTIC Guitar 553219820717
  274. Suzuki Kit Catena GSX R 1000 L7 Ha 143014284563
  275. Tourmax Rear Master Cylinder Kit Yamaha VMX 12 1200 332825736735
  276. Keyboard for HP Pavilion DV6 6163CL Laptop Notebook 182963421152
  277. Mascot Tight Shut Off Valve 401621367359
  278. 925 Sterling Silver Layered Delicate Bracelet with Bead 323442990731
  279. Ford Transit Custom 290 Limited Lr Dcb Panel 401645266845
  280. 2A Fast Charging Braided Micro USB Data Cable 413429028315
  281. Halfords 2 Pen Chip Scratch Repair Kit 201995327266
  282. MERCEDES VIANO 96 03 Sidelight Bulbs W5W 501 Osram 352175668662
  283. 7 9 11 In 1 Instant Film Camera Accessory Set 581761201992
  284. Altronics NC260 720p Day Night WiFi IP 153314379711
  285. JAWS Vintage Classic Movie Poster Art Print A0 601693518830
  286. Franklin Collins DMQ 450 Dictionary Desktop Electronic Edition 362510491259
  287. Faithfull%C2%AE Flooring Trowel Stainless Steel Soft Grip Handle 173216169302
  288. Festo Vacuum Generator 536804 113402467391
  289. YUGIOH Card 3x Horn of Heaven LCJW EN292 Ultra 152508130662
  290. Kit Sostituzione Pistone Husqvarna Cr 125 1997 2013 Vertex 172395455112
  291. UK Ethnic Indian 22k Gold Plated Jhumka Jhumki 262710907133
  292. Count Arthur Strong%E2%80%99S Radio Show The Complete Sixth 113401887193
  293. Kids Box Level 2 Pupils Book by Caroline 332941288502
  294. K N Std Air Filter Harley Davidson 152702524965
  295. Transmission DMF Dual Mass Flywheel Replacement Part 292799250661
  296. New Job Lot 100 Scala Anti Cellulite Slimming Tights 391829130299
  297. BETH NIELSEN CHAPMAN Greatest Hits CD 264084030398
  298. NEW Warren 020009EXX000 50 PSIG 200 Vacuum Breaker 300%C2%B0F Max 163343389747
  299. Lorenzo Henrie Fear The Walking Dead Autographed Photo 173653739471
  300. Baseball Bat Car Steering Wheel Security Lock For 142739503356
  301. Unusual Chinese Cloisonne Straight Sided Bowl 183173427759
  302. Alloy wheels OPEL Astra Caravan A H SW 195 60 R15 122573498866
  303. History ebooks of Yorkshire local genealogy 100 pdf 122445746896
  304. Ost Monster Film Music Best Japan Cd E25 302771687226
  305. A Gorgeous Peter Rabbit Dummy Strap Clip pacifier 223237290463
  306. 1 Or 2 Tubs Of Haribo Sweets Wholesale 441746336381
  307. Yultek 12V Power Supply Charger For Wd Wdh1Cs15000J 390785140767
  308. SMC ZM073H A5LZ E19C Vacuum Ejector and ZSE 00 19CN Switch 173598994587
  309. Karl Lagerfield Sweatpants Defeat Rainbow Quote Print 472090446759
  310. OJ WINKOWSKI 8BALLER SUPER JUICE 60mm 78a BLK 323584604157
  311. FOR DUCATI MONSTER 696 ie 2011 11 EXHAUST 361415103292
  312. Outdoor Hunting Back Arrow Quiver Shoulder Belt Bag 401304269266
  313. PGI 1500 XL Magenta Original Canon 1500 Genuine Printer 562865976021
  314. Christian Camargo Autograph Signed 10x 8 Photo 322491491064
  315. Vauxhall Corsa 14 ecoFLEX Excite 3dr AC 143050553330
  316. Old Silver Cutlery 23 pcs 60 Dining Art 122745866274
  317. Lego Kiss Kiss Tuxedo Batman Movie Keyring 153246718444
  318. Gorillaz Album T shirt NEW 453093442061
  319. Sloan Model V 500 A V 600 A Vacuum Breaker New Old 312310575345
  320. JT 530X1R X Ring Chain Suzuki GSF 600 S 282315722774
  321. Suzuki GS650GL 1981 Replacement Steering Head Tapered Bearing 263739203753
  322. Thule Manual Slide Out Step Caravan Campervan Camper 123544280291
  323. Annie Get Your Gun Various Artists 291184395737
  324. Ultimate Beginner Rock Drums Basics Steps One 253634542498
  325. PGA GOLFER BRAD FAXON HAND SIGNED 10 x 192764806999
  326. All Balls Front Master Cylinder Kit Husaberg FE 332825589677
  327. Pulp Disco 2000 Cd1 Cd Single 312365195083
  328. HANNIBAL LECTER Silence Minimalist Halloween Villain Movie 553353780864
  329. FESTO VAD ME 3 8 Vacuum Generator 35556 392193434389
  330. 2x MERCEDES E CLASS W210 W211 LED BRIGHT 252707072920
  331. 1978 50P COIN RARE COLLECTABLE OLD LARGE STYLE 312259891596
  332. Apex Wave Geometric Wallpaper Grey Fine Decor 401610749422
  333. Neue Geschichten aus der Zachurei Holthaus Hellmut 372547521029
  334. Motorcycle Adjustable Twin Rear Shock Absorbers fit Honda 192500474649
  335. Valeo Crankshaft Angle Sensor 254057 BRAND NEW 173638359891
  336. Chloe Narcisse 100ml Eau De Toilette Fragrance Spray 202487452782
  337. Handmade Doll Clothes Outfit Fashion Party Accs for 631312001955
  338. Honeywell Pressure Reduction Valve D06F 2B 153252113025
  339. Ride On Board With Saddle Compatible With Mutsy 323072692351
  340. 4x Car Golden Crown Tyre Tire Wheel Valve 162738887886
  341. INDOOR OUTDOOR WATERPROOF CAR COVER COTTON LINED For 323485739212
  342. Straw Bag Rattan Handwoven Round Crossbody Handbag Beach 253906414189
  343. Vw Golf Mk Iv 18 T 19 Tdi 162999856696
  344. WOMENS LADIES LONG wavy CURLY WIG FANCY DRESS 521352375003
  345. POLAROID 1000 Land Camera w Manual Flash 283266258719
  346. Willy Deville in New Orleans Cd Neuf 264099570917
  347. Opel High Quality German Car Touch Up Paint 332878937479
  348. New Womens MS Light Camel Tailored Trousers Bootleg 153207048399
  349. Laptop Car Charger for Medion Akoya MD97532 MD97533 113355684657
  350. AC2050 3 50mm length Stroke 20mm Dia Thread Pneumatic 232460010560
  351. EBC OE Front Brake Discs 282mm for Peugeot 292443678157
  352. JMT Lithium Ion Battery YB5L FP For Aprilia RX 332609861567
  353. Hairyworm Animal Painting Print On Clear Hard Phone 621694735261
  354. EGL Certified 075Ct White Real Round Diamond 14K 202544076875
  355. 15000Lm 3x XML T6 LED 18650 Rechargeable Headlamp 531364799636
  356. Jelly Belly Bean Sweet 3D Hanging Vent Set 173646088572
  357. Precious and Grace The No 1 Ladies Detective 163414176410
  358. Yamaha TT 600 S 1994 400613083911
  359. PARKER VECTOR 3 in 1 253998920151
  360. Phil Collins Dance into the Light New Deluxe 173317899979
  361. Honeywell water pressure reducing valve 112919073267
  362. Coil Spring for VW GOLF IV1J1AGRALHAKLAEHAPFAHFASVAGPAQMAHWAKQAPE 113408551511
  363. RK XW RING BLACK 530GXW 112 CHAIN RIVET KAWASAKI 900 272896428348
  364. 2x KIT REAR WHEEL BEARING BOTH SIDES LH 173536333443
  365. BMW K 75 RT 1995 Ipone 104 10w40 261905729817
  366. I Partridge We Need To Talk About Alan 362449931020
  367. 14 x SMA PRO Follow On Milk 800g %C2%A32 192759445658
  368. UK Womens Winter Hoodies Oversized Pullover Tops Ladies 512609358541
  369. ASTON VILLA FC VILLAINS fan TShirt VINTAGE RETRO 432188585790
  370. 3x HP 302 Black Genuine Ink Cartridges For 401578923023
  371. Kawasaki NOS NEW 54018 1015 Tachometer Cable KZ 380702711398
  372. Honeywell water pressure reducing valve 112919074042
  373. Deluxe IBN UV LED Nail Gel Polish Starter KIT 201607111421
  374. Gas Gas 300 EC F Enduro 4T 14 15 DID 192538037585
  375. 78RPM King 4935 Little Willie John Fever 123558830532
  376. Black Red Pleated Skirt For The Older Women 221529256863
  377. Aprilia Amico 25 1996 1997 Blue White 123432382709
  378. EBC YellowStuff Front Brake Pads for Mercedes W115 292431854552
  379. E046 2012 14 15 16 11 17 Suzuki GSXR 283252684197
  380. JT Rear Sprocket 40T 520P JTR21040 Steel Honda 302855557414
  381. steel wheels SKODA Octavia RS Combi 5E 205 75 273605102992
  382. Twins 10 Full Silicone Vinyl Reborn Baby Hair 610909382262
  383. Dehavilland Mens Yellow Check Silk Tie Wide Fit 202514527457
  384. 1942 George Vi Silver Scottish One Shilling Coin 163434718257
  385. Manchester United 2009 2010 Home Football Shirt Size Medium 130993669176
  386. CALEFFI 5350 PRE ADJUSTABLE PRESSURE REDUCING VALVE 1 Inch 113056470622
  387. FIAT PANDA VAN 12 Coolant Thermostat 2004 on 232586219683
  388. Sabrina The Animated Series Zapped Nintendo Game 183507169446
  389. For Lenovo TAB 10 10 TB X103F Tablet 2016 553149167551
  390. Emporio Armani Ar5988 Mens Watch Tazio Chronograph Brand 272813407167
  391. 2x The Fuzztones Band Garage Rock Punk Psych 263604000834
  392. 18V 3Ah Batt for Bosch GSB 18 VE 2 382133668967
  393. Samsung XE550C22 HZ2UK Compatible Laptop Power AC Adapter Charger 362518041476
  394. SHIRLEY BASSEY What Now My Love vinyl LP 143034486812
  395. Armstrong MT 500 1984 87 Michelin Sirac Front Tyre 401514555349
  396. Nike Air Jordan Spizike Trainers Sneakers Shoes Uk 173691535676
  397. Hp Compaq Pavilion 15 N231SL Led Display Screen 156 223139139925
  398. 13 to 7 Pin Trailer Light Board Extension 362479889618
  399. Various Artists Top Gun Original Motion Picture 273617805000
  400. 9ct Gold Sapphire Teardrop D C Earrings Gift Boxed 302954401466
  401. Led Outdoor Waterproof Battery Christmas Lights String Fairy 142548591484
  402. Gpr Hom Powercross Kit Exhaust Suzuki Gsx R 600 162870244613
  403. Tractor Dvd David Brown Newsreel 391997975422
  404. Honda CB1000R 08 Stainless Steel Socket Cap Front 302820140466
  405. Queen Chess Piece Art Photo Print Obama Hope 321837424544
  406. Pierre Cardin Short Sleeve Stamp Tee Mens Gents 502550653099
  407. Worth Dying For Jack Reacher 15 Audio CD 163354546958
  408. Radley Large Handbag in Blue Leather Never 283314170099
  409. 3 x Genuine Hoover Candy Washing Machine Drum 162569308294
  410. Shirley Bassey What Now My 361681663026
  411. Dorothy Perkins Womens Casual Red Bow Top 571111812877
  412. Handmade pram liner set Metallic gold arrows 100 cottonuniversalFunky babyz 163075097996
  413. Kickstart Lever for 1973 Kawasaki Z1 900cc 282872801460
  414. Car Touch Up Paint Toyota BLACK SAND PEARL 191486773890
  415. Bicycle Jumbo Playing Cards Red Blue Deck 2 360383046751
  416. 88 Kangxi Marked Old Chinese Blue White Porcelain 273590583697
  417. Genuine Leather Aluminum Men Women ID Credit Card 123018530067
  418. Left Front Engine Mount 3002211132 fits BMW X3 391638708152
  419. CRG RC2 Brake Clutch Lever Set Kawasaki ZX6R 560832067911
  420. Tena MEN Protective Shield Extra Light 14 322562488102
  421. Metal 38PCS Pocket Hole Jig Drill Round Loactor 292809743472
  422. Wolverine Comic Issue 8 Weapon X Modern Age 351083767974
  423. 50 x Eunicell CR2430 3V Lithium Coin Cell 172898103857
  424. LEXUS IS F 08 12 Rear Boot Deluxe Dog 182778930402
  425. 100 Real Long Wire Hair Extensions Invisible Hidden 522041488613
  426. Wilkinson Straight Cut Throat Shaving Razors 5 X 420861535857
  427. 2x Hiflo Oil Filter 183 Malaguti 200 S 323380038912
  428. Kawasaki Kd125 Kx125 74 76 Ks125 Ke125 Rear Axle 400674428111
  429. 5 X MONARK glow plugs for AUDI A6 322530537675
  430. Yultek 12V Power Supply Charger For Freecom 30715 400670521750
  431. Probe Lambda 8200 036 545 RENAULT VEL SATIS 202542839329
  432. FALLING TO PIECES by ANDY PORTMANN 163423944198
  433. Zafira B Powerflex Black PFF80 1320BLK Front Lower Engine 183217784437
  434. 8Pc DRY WIPE WHITEBOARD PENS Black Red Blue 113430961212
  435. Zapf Creation Baby Annabell Tween Doll 4001167790120 113392410412
  436. VW Transporter Caravelle T4 Air Filter 24D 25TD 332914413656
  437. Airfix un made plastic kit of a 1961 183595711503
  438. New Vauxhall Astra MK3 F 17 TD 155mm Thick 301953541988
  439. Womens Puff Sleeve High Neck Casual OL Shirt 572907039243
  440. 2004 USA United States of America Five Cents 332962002001
  441. V Trec Safety Brake Clutch Lever Set folding 401210907333
  442. VW T5 T6 Kombi 2011 Now Fully Tailored Black Carpet 332495680343
  443. Rent Vocal Selections Essential Musicals by Larson Jonathan 362445525335
  444. 1 2 AC 220V Electric Solenoid Valve Water 123447254285
  445. Electric Underfloor Insulation Boards Premium XPS Heating Undertile 461443908789
  446. MedaSonics II BF4A Ultrasound Stethoscope Doppler Blood Flow 123298200317
  447. VW BORA Estate 9905 FE45133 223276181356
  448. Dell Latitude E7450 Advanced Docking Station Port Replicator 401274679650
  449. Yamaha Oem Flywheel Rotor Mag F3T80371 Yz60 1981 1982 401595093867
  450. 90W Genuine Ac Adapter Charger For ACER TRAVELMATE 192423425393
  451. Newquay Great western beach WHS S 332970028357
  452. Mesh Travel Dog Guard Barrier Boot Liner 323506753278
  453. PRESSURE REDUCING VALVE 15mm CALEFFI 533641H Brand new 183531029137
  454. 1 4 Deep Socket 4 14mm Hex Nut Driver 690404481840
  455. 6 x 18 Clamp On Stainless Steel Silencer 131701027502
  456. Invicta Men Watch Chrono Date Stainless Gunmetal Steel 202535136839
  457. Snap On F17M 17Mm Metric 3 8 Drive 12 183579813720
  458. Fiat Ducato 11 30 JTD 160 3 0 401605563107
  459. MERCEDES BENZ C CLASS ESTATE 280 W204 07 35mm PI 161465881772
  460. Vintage 800 Sterling Silver Shears Scissors Ornate Grape 123545207739
  461. Definitive Detroit Blues 3 Cd Box Set 382649464969
  462. Meyle Heavy Duty Front Stabiliser Link Rod FORD 273521972183
  463. 10pcs Set Cutting Pliers Tweezers 3D Printer Tool 323513453316
  464. nerf guns bundle 312196242110
  465. i SEMI FIT A MAZDA 6 CAR 162438441349
  466. Crane Pressure Reducing Valve PRV D1716 DN50 PN16 183591248122
  467. Universal Magnetic Car Front Windscreen Ice Frost Snow 162493564471
  468. Audi A6 C4 25 TDI Variant1 Genuine Febi 291810655608
  469. V Trec Safety Brake Clutch Lever Set folding 391929955026
  470. Pro Bolt Titanium Front Spindle Bolt M14 x 15mm 401519422851
  471. 4 x IcePure RWF1100A Fridge Water Filter for 282623420528
  472. OPEL Kadett 18 S 0987 0891 E BOSCH SUPER 4 183455030692
  473. JANIS JOPLIN 1968 HUGE Original Photograph by Jim 372546652302
  474. Sherco SEF 300 R i 2015 JMP Black 401194063142
  475. 60W 40W 25W LED Round Golf Light Bulbs SES Small 521765329106
  476. PUIG Black Raptor Screen Windshield Honda CBF 302513806727
  477. Candy Candy Various Artists Album CD 281933926976
  478. Jet K74263 pressure reducing valve 15mm adjustable prv 202485038698
  479. EBC OE Front Brake Discs 288mm for VW 273062976725
  480. Car Headrest Mesh Dog Guard Barrier For Renault 323055131240
  481. 150 Sheets Photo Paper Photo Cards 10x15cm 210g M 382595788100
  482. VALEO Car Heaters 812308 192710706195
  483. Universal Rotating Wallet Case Cover 7 8 410859973129
  484. HV 03 3 8BSP 3 Positions 4 Ways Air Flow 232464157430
  485. UK Womens Oversized Hoodies Jumper Ladies 3 4 Sleeve 521930520308
  486. Vw Golf Mk5 2003 2009 Gti Grey Stitch Black 281208357871
  487. Blood Ties Season Two 3 DVD BOX SET 251737358315
  488. PCB distance polyamide L17mm Colour natural %C3%98cutout3mm 10 163283580321
  489. Rhinestone Crystal Motif Silver Bridal Party Clothing Applique 263425450686
  490. Star Wars The Clone Wars Annual 2010 Misc 312282743259
  491. Stagg STB 1 Electric Bass Guitar Bag 192765839145
  492. Nintendo 64 n64 Golden Eye 007 Video Game 202489149644
  493. FIT DUCATI 996 S 01 EBC Brake 401430605045
  494. 5 Way 2 Position Plastic Black Handle Hand 232468100222
  495. Versailles PS1 Sony PlayStation PAL Game PS2 PS3 183560800611
  496. New Nos Oem Yamaha Hose Fuel Tank 90445 088C5 162659436091
  497. Personalised Silver Plated Initial Letter Alphabet A 502555691608
  498. 18 19 Red Home Adult children Football Outfits Soccer 553299610734
  499. DVDTHE RAG TRADE THE COMPLETE SERIES 1 162414453519
  500. Clutch Cover Pressure Plate For A Renault Laguna 371730316887
  501. Motorcycle KN Air Filter 401399086497
  502. Swan Neck Towbar 7pin Wiring for Hyundai 172117979618
  503. MT1 3 Drill Machine 98mm Long MT1 to MT3 232485425564
  504. 12 Cast Iron Antique Victorian Style ROUND Drawer 232257473123
  505. 12M Home Weather Door Window Draught Excluder Insulation Seal 192746212198
  506. Pasta by Rosa Morelli English Hardcover Book Free 282972586475
  507. 16X Forstner Woodworking Drill Bit Set Boring Hole 292383135242
  508. Jigsaw Puzzles and 3D Puzzle Educational Creative 521164023686
  509. KTM XC F 250 2010 250 CC 392128866930
  510. Black Stitch 2X Upper B Pillar Leather Covers 352286255405
  511. Ford Fiesta Mk7 11 Heavy Duty Waterproof Black 182914685065
  512. Genuine OE EEC Catalytic Converter KIT49 SEAT DIESEL 362264997797
  513. Exide EK700 12V 70Ah 760CCA AGM 323407300908
  514. Original FSC Laptop Power Cable P N Cp311811 Cp311811 01 392162588142
  515. Honeywell D06F 1 1 2 pressure reducing valve 253966284891
  516. 5 10Pcs Ring Size Adjuster Spiral Tightener Stretcher Rings 264078961625
  517. VOIVOD Rrr%C3%B6%C3%B6%C3%B6aaarrr CD Rare 1988 Noise N 0040 3 123535672934
  518. Alan Smith Signed 10x8 Photo Framed Autograph Display 231531882243
  519. Universal Vertical Stand Station Mount Dock Base Bracket 401541758708
  520. New Delphi Crankshaft Position Sensor Ss10896 P Oe 401594234539
  521. 6x CLEAR SINGLE LIGHT SWITCH FINGER PLATE SURROUND 401109169737
  522. Alloy wheels VW Golf IV Variant 1J 215 55 132243783670
  523. Hand Signed Football Index Cards C Page 1 532549570439
  524. GUARDIANS OF THE GALAXY NEW GUARD VOL 3 362226812172
  525. Luxury Leather Black Blue Seat Cover Set 173367630050
  526. The QE2 Cookbook by Gretel Beer Book The 142155776231
  527. Crane Pressure Reducing Valve PRV D1716 DN50 PN16 254004704749
  528. DP61352 Greenstuff Front Right Left Brake Pads Set 222461846663
  529. Star Wars Official Mens Clothing Last Jedi 413341679515
  530. New LCD Screen Display Backlight Touch for Nikon 262819683666
  531. Best of a Decade by Steely Dan 163412890626
  532. Original Bossmobil T%C3%BCrverkleidung Befestigung Clip Fiat Lancia Iveco 113425073384
  533. New First Line Front Lh Engine Mount Mounting 253053558823
  534. calleffi pressure reducing valve 263773259485
  535. Gigabyte Technology GV N105TG1 4GD Geforce GTX 1050Ti 4GB Gaming 123301513204
  536. Brake Pads Rear for VOLVO XC60 20 24 372151601950
  537. Official Guardians Of The Galaxy Vol 2 Get 392054021715
  538. John Lewis Dress Size 16 Pale Blue Linen 292860433589
  539. Battery for Acer Aspire 5730G 7735G 5935G 5310G 182934807036
  540. Digital Optical Toslink SPDIF Coax to Analog RCA 113198836552
  541. Mash Season One box set 283308913988
  542. Tiny reborn baby dolls clothes to fit 264047202689
  543. Fork Seals 1L Fork Oil Suzuki RM465 391908266944
  544. Genuine Leather Wristlet Wrist Bag Strap Replacement For 452456278096
  545. Honeywell pressure reducing valve 263994951642
  546. Fanfou%C3%A9 1 Morde in Abondance Felix Meynet DETEKTIV 122129849255
  547. Michael Buble Love Deluxe CD New 2018 372494851707
  548. ASV Brake Lever Black Short For Suzuki 2010 400406380126
  549. Honda VF 750 FD Interceptor RC15 1983 Full 270983270292
  550. Deephouse Lounge Vol1 by Various CD 163440226826
  551. Draper 38369 10 piece 1 2 Sq Dr 183275430045
  552. 1pcs Ignition Coil Packs MD314582 For Mitsubishi Pajero 232586711531
  553. SKODA OCTAVIA Estate 9810 FE23366 223271691795
  554. Pressure Relief Valve 1 1 2 6Bar SYR 283299976139
  555. pt0054 Ryhill Railway Station Yorkshire 391884175779
  556. Womens Off The Shoulder Bardot Midi Skater Dress 601563478173
  557. JT Rubber Cushioned Front Drive Motorcycle Sprocket JTF580RB 192449552617
  558. Womens PU Leather Small Mini Wallet Card Holder 641200979489
  559. New Citroen Saxo 16 VTLVTR Genuine Mintex Rear 331919101184
  560. Zara Womens Striped Bell Sleeve Top Size Small 223291337351
  561. Ultra Slim Recessed LED Flat Panel Ceiling Lamp 492745137202
  562. Western Winds The Bront%C3%83%C2%ABs Irish Heritage Paperback Chitham 382602348037
  563. Used Digital UV 58mm Lens Filter Made in 202487452834
  564. Worker Modified Dagger Cover Shaped Toy Accessories kit 162976948114
  565. HXSJ Black Wireless Mini Bluetooth 30 Optical Mouse 263828901817
  566. Guernsey %C2%A35 Pound Crown Commemorative Coins BU 553353651164
  567. New CNC Road Mountain Bike Platform Pedals Flat 572947971778
  568. Waterproof Chef Apron Catering Cooking Kitchen Butcher Unisex 601625471471
  569. VTR1000F V F F storm 1997 Brembo Road Sintered Front 261633935576
  570. Jet K74263 pressure reducing valve 15mm adjustable prv 323440730925
  571. Land Rover Defedner 130 Carnaby Blue Black Seat 142950766103
  572. Pack of 6x 24x 100 Egyptian 512615226230
  573. Rose Gold Dipped Sterling Silver 2mm Tube Sleeper 460998154114
  574. Extreme II Pornograffitti CD 1990 Compact Disc 163425276763
  575. Left side for Seat Cordoba 1993 1999 wing door 132341489956
  576. Nissan Micra 12 16v Initia 20065 68000 MILES 292877412941
  577. Flange Towbar 13pin C2 Wiring kit for 173384160693
  578. Honeywell water pressure reducing valve 112919071663
  579. Newton john Olivia Beth Niels Liv On NEW 362254774981
  580. NEW Huawei 02351VBT P8 Lite 2017 PRA L31 Black 192755537526
  581. Crossbody Leather Flap Bag with Decorated Chain Black 540860016176
  582. THE MOVE 1970 BRONTOSAURUS 45rpm vinyl 7ins SINGLE 273592155805
  583. Xiaomi Redmi Note 6 Pro 4G Smart Phablet 413584843845
  584. Yu gi oh The Duelist Genesis Commons TDGS EN001 037 630055661548
  585. White Stitch Roll Over Bar Leather Skin Covers 351290223873
  586. Geographical Norway Mens Warm Fleece Winter between Season 631439347280
  587. wbc GB PHQ CARDS 1978 131566207583
  588. 12 14 650cc CFMOTO 650NK Right Front DELTA RDN4 142513124790
  589. 22mm pressure reducing valve 123406490784
  590. Universal Waterproof Rain Cover Camera Lens Protector ForNikon 233059015699
  591. 61x 185cm Yoga Mat Thick Gym Exercise Fitness 563641107517
  592. Geta severus dopelt zirka 203 153301706328
  593. Build the Swing of a Lifetime The Four step 163418252429
  594. How The Grinch Stole Christmas New Region 1 351403521058
  595. Kingston 2GB 1333MHz DDR3 Non ECC CL9 SODIMM SR 232969463641
  596. 16 Universal GTX Wheel Cover Hub Caps x4 152501430215
  597. 8th Wedding Anniversary Personalized 2010 gift for her 273554198927
  598. UK 3 PINS CE Mains Charger for Nokia 291066512888
  599. 28 Realistic Reborn Baby Doll Toddler Life like 283234437390
  600. Last Of The Summer Wine Series 1 162224187410
  601. New Zealand 1948 Florin 2 George VI 121972160405
  602. Reliance Valve 475 Bar Gledhill Unvented Cylinder Hot 123412184131
  603. Battlefield 1 Sony PlayStation 4 2016 173696501964
  604. Suzuki GSF 400 V M Bandit VC Engine Model 271091023824
  605. WILLIE ROBERTSON SIGNED AUTHENTIC DUCK DYNASTY 8X10 PHOTO 173476225785
  606. MITSUBISHI i MiEV Heavy Duty Black Waterproof Car 122807231665
  607. Honda VF 750 SC Sabre RC07 1982 750 260981606369
  608. Bag Purse PU Leather Shoulder Hobo Bags Ladies 462719788366
  609. Saved By The Bell Complete 3rd Season Dvd 283165310847
  610. Personalised Red Glitter Christmas Eve Bag Jute Bag 332551494563
  611. All Balls Swing Arm Bearing Seal Kit for 131966393008
  612. Zimmermann Brake Discs Vented %C3%98259 Pads Front 371984575599
  613. water pressure reducing valve 123555466630
  614. Aspire Puxos Kit 163161718470
  615. Oil Filter Hiflo Premium HF303 Kawasaki VN 1500 332700648864
  616. Egyptian White Faience triad Amulet L435 362144776847
  617. Lemark Cp110 600 Ignition Coils For Renault Super 291437855536
  618. AZZOR Wireless 6D Rechargeable 2400DPI 6 Buttons Optical 113154374990
  619. EBC HH Front Brake Pads For Ducati 2006 141167208274
  620. Mini Vernier Caliper Math Measure Tool Shape Slider 202533184555
  621. REPLACEMENT KIT 4 LT OIL REPSOL OFF ROAD 10W40 282657268006
  622. 4x steel wheels SEAT Alhambra 7N 215 60 R16 123540166895
  623. Laser Tools Deep Impact Socket 1 2D 10 32mm 6pt 610813123015
  624. audi Q5 2009 2016 Warning Triangle 8K0860251 113460643411
  625. Armstrong Pressure Reducing Valve Rd 11U 1 2 143055412252
  626. Beautiful Dummy Clip Baby Soother Clips Chain Holder 283262965532
  627. x15 Rust Oleum Painters Touch Craft Enamel Spray Paint 372005910881
  628. Ringke FUSION Crystal Clear PC Back TPU Bumper 471307508624
  629. BeswinVR AK47VR Rifle HTC Vive Pro 20 Vive 10 332909305073
  630. RG Fork Protectors Kawasaki ZX9 R E2 FP0011BK 372047905806
  631. UK LED Snowing Outdoor Xmas Landscape Projector Light 173504485743
  632. Raceland Ultimo Coilovers Suspension Kit VW Golf MK6 323409083461
  633. ladies marks and Spencer red mix stripe long 312394693714
  634. Honeywell pressure reducing valve 153204809680
  635. Gong for Striking French Mantel Clock 173502215667
  636. All Balls Lower A Arm Bearing Seal Kit For 162443533972
  637. New Ring H1 XENON ULTIMA Max Car Hedlamp 121033012982
  638. 18x Size 16mm Faceted Heart Cut Glass Crystal 331065923777
  639. Estee Lauder Double Wear Foundation samples 5 10 15 423197841562
  640. Eyelet Ring Top CHENILLE PLAIN HEAVY LINED Woven 610541395113
  641. SAMSUNG J5 SM J5108 Micro USB Charging Connector Port 142579676305
  642. 50 Meters String Tie Balloons Curling Ribbon For 472304247424
  643. 33 2830 KN AIR FILTER fits SKODA PRAKTIK 12 291358429101
  644. Sia Everyday is Christmas 3 Extra Tracks CD 332961681794
  645. 2006 TOYOTA COROLLA 14 VVT i 5DR O S DRIVER 192748356938
  646. 2015 Vauxhall Astra Tech Line Cdti Ecoflex Diesel 323548310912
  647. 3x Hydra Fiamma Chimerical YU GI OH PRIO IT027 Ita COMMON 292644544550
  648. 5V 2A Mains AC Adapter Power Supply Charger 142610687424
  649. Honeywell Pressure Reducing Valve 1 2%E2%80%9D Female Bsp Do6f 1 2B 153269617109
  650. Kit Shad Top Case Sh59X Panniers 3P 372458204426
  651. Name Of God Allah in Arabic Chain Necklace 153312450792
  652. Renault Laguna 19Dci Starter Motor 8200096510 202304800577
  653. steel wheels OPEL Astra Sports Tourer GMIH 185 65 273604679710
  654. Lenovo B5400 Model 20278 Laptop Screen 156 LED 362309551528
  655. 4 x Super Soft Black Faux Fur Cushion 332921978578
  656. ADVENT LTN156AT02 W04 New 156 Laptop Display LCD Replacement 201847629083
  657. RWC PRED315080 315i Capillary Series Pressure Reducing 153293098757
  658. Triumph Sprint Executive 1998 2003 HEL Full Length Race 192223247860
  659. Fender Electric Guitar Player Telecaster Pau Ferro Fingerboard 254008038635
  660. 5 10Pcs Abrasive Zirconia Sanding belts 330 X 10 457 222977989665
  661. Sexy Womens Office Trousers Ladies Classic Casual Pants 551063061101
  662. Turks Caicos Islands Flag Silver Cufflinks Tie 253632974919
  663. Hydroponics Grow Tent Room 600D Silver Mylar Growing 432128963479
  664. simplehuman Rubbish Bin Bag Liners Fit Choice of 591064865254
  665. 2015 Gb Qe2 Dy15 Star Wars Commemorative Prestige 202547758848
  666. Vickers Pressure Reducing Valve 163311881062
  667. Barbara Rush in The Black Shield of Falworth 192606578257
  668. Motion Pro 02 0217 Black Vinyl Pull 231989131357
  669. Bosal Rear Exhaust System Rear Silencer 185 665 I 153260652485
  670. Antique Austrian Cold Painted Bronze Miniature Terrier Dog 113216366779
  671. One Direction Poster Kunststoff Rahmen Gold 50x40cm AE0KP 362486914888
  672. Yamaha YZ125 2005 2017 14 47 ProX MX 183218050454
  673. Pack 50 Sheets A4 Double Sided Pearlescent Paper 510974062286
  674. Handmade Oval 1513ct Unheated Citrine Tanzanite 925 Sterling 233068354300
  675. Ein Jahr an deiner Seite Roman Saunders Kate 202546277328
  676. Diamond Infinity Pendant Necklace 10K White Gold 05ct 631670126057
  677. Water Pressure Reducing Valve Repair Kit 3 4 In 183515736556
  678. Universal Billiard Ball N08 Car Gear Shift Knob 173613583755
  679. George Benson %E2%80%93 In Your Eyes Warner Bros 153281418498
  680. UK 8 24 ZANZEA Women Check Lapel Long Sleeve 521768079156
  681. RAY BAN Mens Polarized Designer Sunglasses Gold Rectangle RB 163434649782
  682. Garden Outdoor Furniture Cover Waterproof WashableDurable GREEN 452927382260
  683. 2263942 Celine Dion All The Way A Decade 183588047276
  684. 9Ct Gold Double Row Ethiopian Welo Opal Ring 172862459491
  685. Buffy the Vampire Slayer Spike and Dru Alls 312341412510
  686. Queen Poster 3 141646215378
  687. 6 x 20 Clamp On Mild Steel 131725257605
  688. Husqvarna Te610 Engine Oil Seal Kit 1993 401541009663
  689. Honeywell pressure reducing valve D06F 3 4B 183580438288
  690. 10m 200m Rice Wire Copper Fairy String Light Lamps 182938574245
  691. OEM For Sony Xperia L1 G3311 G3312 G3313 112892060243
  692. Yamaha XJR1300 2002 2003 530 EK ZVX3 Chain 252794815368
  693. Hardback Book Jingle Bugs By David A Carter 183604828574
  694. UK Newborn Baby Infant Girl Crib Pram Pom 192616426230
  695. Vintage Raleigh 21 Special Club Sports Bike Model 273380827429
  696. VW Mk2 Golf Jetta Front 1 4 Window 162995017571
  697. The Big Bang Theory The Complete Seventh Season 143063574323
  698. Honeywell Pressure Reducing Valve D15S 65A 192676927353
  699. 2 x Varta Industrial 9V Alkaline battery LR22 292725844163
  700. Honda TRX 300 FWV 1997 Semi Synthetic 10w40 262086324696
  701. Autophix OM129 OBD2 Scanner Diagnostic Tool Check Engine 142920543250
  702. Ellas Kitchen The Easy Family Cookbook by Ellas 362469838173
  703. Riverdale Southside Serpents Jughead Jones Sprouse Leather Jacket 183379477385
  704. Giantco Sprint 50 4T Sport 2009 2015 Carburettor 361891049941
  705. 1 piece Orange Balloon Cup Stick 460828195856
  706. Deluxe Washable Cat Kitten Pet Bed Igloo House 263759194600
  707. 1983 1984 Kawasaki ZX1100 GPZ Motorcycle All Balls Wheel 202336001107
  708. ATLANTIC STARALWAYSG EX2 Track 7 Single Picture SleeveWARNER BROS 113444961290
  709. New Reversible High Torque Turbo Worm Geared Motor 511499954270
  710. Home Alone 4 DVD 2006 173705159335
  711. Reliance Pressure Reducing Valve 192759091689
  712. Sony Limited Edition Multi Region RDR HXD995 500GB HDD 322439786861
  713. 4X 13 Inch Rapide Nc Wheel Trims Cover 222658259481
  714. MORTAL KOMBAT Mortal Kombat Mortal Kombat Annihilation Mortal Komba Blu Ray NEW 391867134592
  715. Touch and Feel Playbook by Eric Carle 332922600720
  716. Genuine Land Rover Left Hand Parking Brake Cable 292890475506
  717. Stillness Speaks by Eckhart Tolle Whispers of Now 253648829161
  718. KN Air Intake 69 Series Typho%E2%80%A6 Kit FOR 253461282071
  719. eBay Responsive Listing Template Mobile Friendly Design 2018 172618782004
  720. Cometic Bottom End Gasket Kit C3360 312287509263
  721. spirax steam trap 1 2 3 4 FT10 FT11 FT43 FT40 223290602163
  722. 112 Doll House Accessories Mini Glass Biscuits Candy 153155472688
  723. V A JAZZ CLASSICS IN DIGITAL STEREO VOL II 153290130386
  724. Wheres Wally The Totally Essential Travel Collection by 142512603942
  725. AUTHENTIC PANDORA St Silver Cubic Zirconia OCEAN 452764414420
  726. Trivial Pursuit Family Edition Game 2008 Celebrating 25 331731379399
  727. PD06KR277 EBC Rear Brake Kit Greenstuff Pads 401359986867
  728. Women Firm Control High Waist Long Leg Tummy 562021425195
  729. Set x 24 Man Land Worldwake%C2%A0 English%C2%A0 202546794964
  730. AFR 2000 AL 2000 Pressure Gauge Air Compressor Filter 232459953207
  731. Mens LCJ Denim Super Skinny White Jeans Slim 282696562836
  732. Rear Bushing Right Front Arm Hydro For Mazda 123412562098
  733. PICTUREGOER MAIN Series 1930s Film Star Postcards 423813167028
  734. Microsoft Office 2016 Pro Professional Plus 32 64 Bit 183599614813
  735. Volkswagen High Quality German Car Touch Up Paint 312315664632
  736. APPLE Cinema HD Display AC Power adapter 65W 332600096323
  737. Genuine Samsung NP300E5A S04GR 60W AC Adapter Charger Power 331524327731
  738. Aor LA Darkness CD 382569127820
  739. STAR WARS Episode 1 Phantom Menace Kaadu 202448867981
  740. Baby boy bundle 3 6 months 14 Items 153232165444
  741. AR2000 Model 1 4PT Mounting Adjustable Pressure Pneumatic Regulator 232460032874
  742. Shroud rad kxf450 09 gn KAWASAKI KX 263624943451
  743. Seat Cordoba 6K1 6K2 14i 16V Genuine Intermotor 291703515769
  744. Awesome Universal Digital Multi Meter Test Lead Probe 153308313193
  745. R39 R50 R63 R80 LED Reflector Lamp 3W 4W 5W 6W 7W 9W 690682318628
  746. Fits Ford Escort 1994 1998 16 Coolant Water Temperature 202456150983
  747. Handmade Wooden Barber Razor Shavette Shaving Cut Throat 254027390232
  748. Good Charlotte The River rare Cd 372537406125
  749. Abs Front Brake Pads Fitting Kit Shims 1611Q 153036396218
  750. BRYAN ADAMS Best Of Me CD Europe AM 264095180482
  751. Esjot Rear Sprocket 47T 520P ALU Silver Aprilia 332863763965
  752. PRE ORDER Celtic v Dundee 2018 19 brand new football 123510683477
  753. 200M 8F Aluminum 8 Row Stations Manifold Solenoid Air 232466830432
  754. Ebc Ultimax Rear Pads Dp1577 For Bmw 320 121477774423
  755. Samsung R580 Np R580 Genuine Lcd Right Side Hinge 263395361786
  756. Now we are six by A A Milne 302407178306
  757. Stuntman platinum Pal Spain PS2 312082292155
  758. 15pcs set Women Mermaid Tail Make up Brushe Foundation 254012884715
  759. WWE 2017 Event Used MAT SHIRT 671344513598
  760. 3xBoots Smooth Care Washable Warm Wax Roll On Sensitive 263748124714
  761. 1980 1990 Russian Soviet Gold Badge Insignia Enamel Pin 292062804475
  762. David Gray Life in Slow Motion CD 381651774479
  763. SCV 10CK 1mm Nozzle Dia 1 8PT Female Thread Vacuum 232468149831
  764. For Samsung Galaxy A7 2017 Mobile Phone 16GB 332348647183
  765. Womens Sexy Clear High Heel Sandals Perspex Strappy 502351834620
  766. 35mm Auxiliary Aux Male to Male Stereo Cord 323396771284
  767. Boys Pyjamas Long Sleeve Pokemon Paw Patrol Minions 590856379856
  768. Cheap original Xbox console complete set up fully 264070001384
  769. Compatible Black Ink Cartridge x 2 for HP 222979261083
  770. Dolls Shoes Sandal Flat For 18 inch American 582753347078
  771. IRWIN Power Screwdriver Bits Pozi PZ2 50mm Pack 401544666398
  772. Set Transmission Trofeo Chain Sprocket Sprocket Yamaha Xv 323571158637
  773. Womens FairIsle Luxury Jumpsuit Ladies All In One 492173034550
  774. 2 Pcs 10mm Two Way One Touch Fitting 232477311089
  775. job lot 54 hand made greeting cards of 253640875126
  776. For DJI Mavic Air Quadcopter Drone 2375mAh Intelligent 332617340056
  777. Daredevil Comic Book 178 Marvel Comics 1982 NEAR 140398491878
  778. Rustic Genuine Amish Farmer Quality Primitive 22 INCH 230967727418
  779. Honda Cr V All Years Dynamic Anti Theft Lockable 263200838725
  780. The Start Up Formula 6 Easy Steps to Start 253032006219
  781. Der Erste wbg Philipp von Zabern 332967784653
  782. Silver Pentagram Pendant Viking Raven Necklace Sacred Vintage 263807244632
  783. Tusk Top End Gasket Kit Honda CRF250R 332406592991
  784. LED Solar Power PIR Motion Sensor Garden Yard 302973541786
  785. 5 Pcs 3 8 PT Thread Sintered Bronze Pneumatic 232477377234
  786. Celcus RC1825 Remote Control For Model LED19913HD 272405933908
  787. X Men Phoenix Endsong 2 NM 192171798905
  788. The Rescuers Down Under Disneys 29th Animated Classic 152850531427
  789. 45W Acer ASPIRE ES1 531 P404 Adapter Laptop Battery Charger 323599180062
  790. Gemondo Sterling Silver Blue Topaz Marcasite Art 153205800407
  791. Stoke City Football Shirt Home Red 254026291701
  792. Watch Strap For Fitbit Charge 2 Replacement Band 432158650733
  793. Sports Deluxe Seat Cover Set Black Red 182500259065
  794. Anlasser Starter Relais f%C3%BCr Suzuki RF 600 900 Yamaha 352139492711
  795. 10Pcs SL6 01 1 8 PT Male 6mm Tube Pneumatic 232477610916
  796. Villanova Wildcats 2018 NCAA Champions vinyl decal 182355561294
  797. STEAMPUNK RETRO GEARS COGS CHARMS PENDANTS 30g RANDOM 282461588864
  798. Luxury Women Teddy Bear Feel Oversized Faux fur 273551510083
  799. Luxury Women Teddy Bear Feel Oversized Faux fur 273551510083
  800. New Honda Xr125 Xr 125 Piston Kit 230732332632
  801. Duke Ellington Great Original Performances 1927 1934 LP BBC 401306093568
  802. 2018 1oz Austrian Silver Philharmonic 1 ounce Silver 202168108214
  803. Mercedes Saloon W124 300 Turbo D 4matic 434mm 301976453401
  804. Fluval Filter U Media Foam Carbon Pad 490737375987
  805. Skyscraping ABC CD New FREE Fast 362516239876
  806. 200M 2F 1 4PT Thread Tube Hole Aluminum 2 Row 232484251888
  807. Windscreen Snow Frost Ice Cover For Mitsubishi Colt 183502962836
  808. New HS 1115K 10in1 Pro Butane Gas Soldering Iron 572898836644
  809. Virgin Islands Flag Cufflinks Tie Clip Matching Box 253632967847
  810. Original Ac New Adapter Sony Vaio Pcg R505E 90W 310656466693
  811. 5 x Quality Car Auto Automatic Brake Clutch 302304366181
  812. Fiat Panda 2003 2012 Rear Wiper Arm Blade 271371691362
  813. Assembled 68W 68W HiFi LM3886TF Stereo Amplifier AMP Board 253885970975
  814. All Balls Linkage Bearing Kit for Suzuki RMX250 113231471468
  815. Mini Blackboard Chalkboards Wooden Christmas Decoration Tag Drawing 413436850051
  816. Towbar detachable FIAT Tipo Combi 16 13pin 263962193488
  817. Aluminum 30mm Inner Diameter Linear Rail Shaft Support 232485371212
  818. Disney Fairies Poster Kunststoff Rahmen Weiss 91x61cm AH3OJ 401634941062
  819. Pair Womens Ladies Waterproof Winter Thermal Snowboard Ski 563602788212
  820. 6600mAh battery for CANON ES8100VES8200VES8400VES8600BP 945G10G10HiG15Hi 153129748264
  821. 6pcs Carbon Fiber Style Car Front Bumper Lip 312158997328
  822. Cute Cartoon Eye Mask Cover Travel Sleeping Eyepatch 562503782264
  823. 2008 Iveco Daily 35S12 23 06 2012 OSF Headlamp 233045995309
  824. OIL FILTER OIL Oil FILTER POLARIS Xpedition 325 163111349254
  825. 4mm Natural Colorful Agate Gemstone Round Loose Beads 273610697194
  826. Diorish Cat Eye Cut Out Style Rose Gold 372527902975
  827. C32 ER32 100L Milling Lathe Clamping Straight Collet Chuck 150mm 232485404481
  828. steel wheels BMW 1 3T 1K2 195 55 R16 153300491449
  829. Resistance Bands Exercise Loop Weight Training Fitness Crossfit 253597653980
  830. Kawasaki GPX 600 R 1994 0600 CC 360804357292
  831. Doll Premature Baby Child Sweater Cardigan Hat 292864556187
  832. Smart Slime Quick Tyre Puncture Repair Kit for 173387605666
  833. 50pcs Guitar Bass Pickguard Screws for Electric Guitar 163389501726
  834. Electricity Monitor Power Energy Tester Voltage Analyzer Digital 441947873858
  835. DriveTorque Stage 3 Clutch Kit Ford Fiesta Mk4 122810404957
  836. London 2012 Team GB Gold Medal Winners Collection 323621230453
  837. 2 x KILEN REAR COIL SPRING PAIR SUSPENSION 263096006555
  838. Solid 9ct Yellow Gold Circle Pattern Open Drop 153195858210
  839. Baby Boy Girl New Born Gift Set Keepsake 500787618508
  840. Hadrill horstmann lamp 263964138112
  841. Motorcycle Passenger Seat Gel Pad for Kawasaki Cruiser%C2%A0Vulcan 253007042793
  842. Long WP28 12T 12v replacement sealed lead acid battery 264062492905
  843. Trumpeter Models 1 35 Russian T 80U Main Battle Tank 273524788303
  844. 16 Full Body Silicone Reborn Dolls Lifelike Baby 263986346520
  845. Savarez 510AR Guitar Strings Alliance Cristal Cantiga Classical 253939246575
  846. New Toshiba Satellite L655 177 Replacement Laptop Keyboard Black 311487823068
  847. DELUXE RED RACING VAN SEAT COVERS 2 1 For 323372358973
  848. To Fit A Ford Transit Motorhome 2010 Seat 272343385099
  849. 2019 New Sterling Silver Stamped 925 Earrings Drop 462776827497
  850. Watts N45BU M1 Water Pressure Reducing Valve 25 75 Psi 233038074472
  851. Vauxhall Astra G Corsa C Combo C Meriva A Vectra and Zarira 171418451684
  852. 1822 Original Antique Print FRANCE View of 382664047199
  853. ECS 581 SIBELIUS Symphony No 1 302772437129
  854. Car Dog Guard Barrier Safety Protector for VAUXHALL 371744926003
  855. VW Polo 6NF Van Bosch Superplus Front 291681873870
  856. 10X Wool Ball Felt Polishing Buffing Round Wheel 312355680399
  857. JOHNSON 28 Tennessee Titans American Football Jersey Shirt 152914174538
  858. Sunmaster 600W Watt Hps Dual Spectrum Grow Light 461407722106
  859. Mini Flexible Clip On Bright Book Light Laptop LED 283316933097
  860. 4x alloy wheels VOLKSWAGEN Golf VII Variant 1 KM 122573438642
  861. Reliance 22mm MBSP 315i Series Commercial Pressure 233041111872
  862. Front EBC Organic Fibre Scooter Brake Pads 273549292447
  863. Mens Hooded Cardigan Crosshatch Biteback Heavy Knitted Hoodie 122909027524
  864. Lighthouse Stock Book Lsp 4 24 191854058720
  865. Football ProgrammeCRYSTAL PALACE v BARNSLEY May 1982 382663006617
  866. James Bond The Body Dynamite 2A 2018 Casalanguida 132888435472
  867. 3 Core 075mm 6 Amp PVC Flexible Cable 461402522362
  868. 2018 Holden Motorsport Collection RAM 50c Coin 123424757585
  869. CHEIFTAIN Spirit Of Bruce Modern 8 Yard DELUXE 401423188953
  870. Advantay Pressure Reducing Valve 10 0 Bar 233046680560
  871. M35 Long Electrical Screws BZP Electric Light Switch 552680405969
  872. Xena Warrior Princess by Trebov Bob Paperback Book 302779834387
  873. Large French Antique Deep Carved Architectural Panel Door 254000482549
  874. ALLOY WHEEL MAK PANORAMA MERCEDES E KLASSE 8x18 5x112 362298237884
  875. Very Good0582772680 Henry V William ShakespeareLangston DavidPaperback 312372459626
  876. Rexroth Zdr 6 Da3 40 75Y Pressure Reducing Valve 253995977396
  877. Personalised Name Lurcher Wrought Iron T light Candle Holder 362290404606
  878. Paw Patrol Launch N Roll Lookout Tower 132884972665
  879. ELVIS PRESLEY The Legend Lives On Readers Digest 253775966021
  880. Time Team Series 16 Dvd New Region 2 233059160496
  881. 4 Front Brake Pads Brembo Sintered Road Racing 07Gr62Sc 142575731455
  882. Batteria Precaricata Motobatt Mbtx4U E Ton Nxl 90 1999 273288332824
  883. Acer Extensa EX2540 1TB 1 TB HDD Hard 232900658397
  884. 4 Port HDMI Splitter Cable Ultra HD 4K 2K 163153095301
  885. 2PCS VGA DB15 15Pin D SUB 3 Rows Female 253820718620
  886. Lexus GS HB4 501 100w Super White Xenon 292523047569
  887. Cube Diamante Upholstered Fabric Bed Frame Velvet Chenille 492816910406
  888. 20 inch JUDD T313 5x1143 ET35 9J BLACK 132759617380
  889. Honeywell V5005T Kombi FCU is a Pressure Independent Control 263979386313
  890. Pandora Fairytale Sparkle Ring sterling Silver S925 ALE 292879324476
  891. Blondie Atomic CD 1998 254028679787
  892. Old Vintage Antique Piece Hand Carved Wooden Indian 113471549373
  893. Personalised Invoice Book Duplicate Ncr 552540776213
  894. Alloy Wheel Mak Wolf Black Mirror 18 80J 253868883458
  895. LUCAS LLB380 12v 21 5 W BAY15D BRAKE TAIL LIGHT 410786725393
  896. Volkswagen Fox 4 Piece Anti Slip Black Grey 262421589579
  897. White Stitching Fits Jaguar Xj40 Xj6 86 94 Handbrake 231120130522
  898. Honeywell pressure reducing valve 263994949391
  899. Star Wars Thrawn 1 Marvel Comics Variant April 132720058780
  900. EBC 318mm REAR BRAKE DISCS PADS KIT 143043419385
  901. TRW Front Brake Pads Set GDB1633 BRAND 153169169759
  902. Asahi Pentax ESII ES2 35mm SLR Film Camera 264071176872
  903. Mercedes Benz E klas W211 Heater blower fan A2308210251 302938306436
  904. Howard The Duck New Region 1 Blu Ray 331827404097
  905. 4 Vintage Waterford Colleen Claret Wine Glasses 4 153168173728
  906. Kids Mermaid Tails Swimming Diving Monofin Girls Adjustable 123145938539
  907. Victory Touring Cruiser 2002 2006 Koyo Wheel 152939641274
  908. Charger Adapter for HP Pavilion 17 F263UR 17 F264NB 182947060116
  909. Supreme Kate Moss 2 Fashion Model Icon Street 453145945709
  910. Town Country Womens Purple Comfort Fit Premium 113344779124
  911. NWT 160 ASOS WHITE label Funnel Neck Wool 553345597777
  912. Adjustable 1 2 Bspp Brass Water Pressure Reducing 273287577215
  913. TRI ANG HORNBY TWO R608 3rd RADIUS CURVES 113478496109
  914. CORRUPT Harvey Keitel John Johnny Rotten Lydon 361665429207
  915. Ford Lotus Cortina Air Flow pewter effect 222129282133
  916. Beethoven The Complete Piano Concertos 5099920631123 352516482790
  917. ARK Survival Evolved Xbox One BRAND NEW SEALED 142826397269
  918. Anime DVD Yamada kun and the Seven Witches Vol1 12 262014054480
  919. Various Colour Mouse Mat Wrist Gel Rest Support 183520291340
  920. The Polymer Clay Cookbook Tiny Food Jewelry to 392152797102
  921. Shock Proof Heavy Duty Hard Stand Case 222399011005
  922. Various Artists Nothin But The Blues 302154898695
  923. RWC 1 1 4 MBSP 315i Series Commercial Pressure 273468142849
  924. The Miracle of Grace by Kate Kerrigan Good 362439171308
  925. RG Racing PAIR ROUND CRASH PROTECTORS BOBBINS for 192513104519
  926. Fits Nissan Bluebird WU11 Estate Aero VU Front 291681210073
  927. Sara Jean Underwood Glossy Photo 28 192549807391
  928. New Kids Tracksuit Set Fleece Hoodie Top 521603420385
  929. KiWAV Tulip side mirrors glossy black M10 for 352534717066
  930. License Plate Holder Adjustable X Bike Suzuki Gsx R 142828427089
  931. Sarah Raven Cut Flowers Malope Vulcan seed 122083594438
  932. Vickers XCG2V 8FW 10 Pressure Reducing Valve Valve 283221983343
  933. Funko POP Games Five Nights at Freddy Funtime 322518636340
  934. Honda Civic incl EJ EK Wiper Blades Aero 192403253095
  935. New Genuine British Army Issue MTP Multicam Camo 323495977269
  936. Women Winter Leg Warmers Crochet Knitted Faux Fur 392181905819
  937. RG Indicators Tail Tidy Plate Holder KTM 323380050325
  938. Emma Bridgewater Waitrose Florist Mothers Day 2018 15 192766423607
  939. Perry Miniatures 28mm Mounted Men at Arms 1450 1500 332795550944
  940. Sweethearts Stolen Kisses Love Me Tender 163433988799
  941. Official Everton Football Third Shirt Jersey Tee Top 541942949352
  942. Universal Footmuff Cosy Toes Buggy Pushchair Stroller Pram 423214197196
  943. Yamaha 100 Neo S 100 1999 Fork Oil 252773656166
  944. 1 2%E2%80%9D Steam Trap 10 Bar 292652126198
  945. 4 Car Anti Theft Lockable Dust Caps HONDA 183375134220
  946. Original Old Antique Print 1883 Portrait Miss Eweretta 143059489810
  947. Exhaust Mivv Gp Steel Black Triumph Speed Triple 182820005100
  948. EBC FA419 HH Rear Sintered Brake pads for 351732941375
  949. Tempered Glass Screen Protector Film Guard for Nokia 502473893096
  950. PS4 NBA 2K18 Legend Edition 173674600711
  951. Wholesale Light Up Flashing Teeth Multicolour LED 202378332079
  952. Mazda 2 DY 13 L Variant2 Genuine Lemark 361507861717
  953. White Stitch Genuine Leather Manual Gear Gaiter Fits 352418237170
  954. Paul Klee Kunstdruck Kunststoff Rahmen Gold 40x40cm AZ4YE 401636813402
  955. Honda CBR900rr FireBlade SC28 Fuel Tank CBR900 CBR 132894262014
  956. Altenic Caleffi Preset 3 Bar Pressure Reducing Valve 292854786704
  957. Adidas Exercise Gym Mat 10mm Thick Large Training 112649337802
  958. MAC Powder Blush Pro Palette Refill Pan Choose 122072510174
  959. Ladies brown tan boots Suede material with heel BNWOT 264100439504
  960. EBC GD Front Brake Discs 296mm for BMW 282842192541
  961. UHF Wireless Microphones Stage Wireless Headset Microphone System 233020967186
  962. Skoda Felicia Estate 94 01Premium Top Car Frost Cover 202109387353
  963. 10 02 1974 Walsall v Plymouth Argyle folded Thanks 372514538207
  964. Comedian Jim Belushi Signed Saturday Night Live Rare 181408433781
  965. JENNIFER RUSH Jennifer Rush 1C 568 0777 7 142818012018
  966. Remanufactured XL Black x 2 Colour x 1 163094296447
  967. Rexroth Zdr 6 Da3 40 25Y Pressure Reducing Valve 312275335990
  968. Tropical Quilted Coverlet Pillow Shams Set Palms 283299480077
  969. Wuthering Heights Emily Bronte 1971 Book 47546 372248105735
  970. 2017 2018 EUROCUPS PROGRAMMES CHL EL updated 492881761420
  971. EBC REAR USR DISCS GREENSTUFF PADS 261mm FOR 121927904180
  972. For Huawei P20 Pro Lite P Smart Shockproof 651249235576
  973. Vtg Snap On 3 8 Dr Socket Set10 pc1 4 7 8Mixed 6 273422097401
  974. Citizen Signature Moon Phase Flyback Eco Drive Original Box 173673621331
  975. Rexroth ZDR6DP3 40 75YM Pressure Reducing Valve 312275360082
  976. Jurassic World Jurassic World Fallen Kingdom Blu ray 273624594409
  977. Kawasaki ZX6R 03 04 SP Engineering Polished Stainless Stubby 281582058225
  978. Various Essential Lounge Global Various CD 302688326068
  979. Adele 21 Cd free Pp 392189554491
  980. Renault trafic 25 DCI DELUXE RACING RED VAN 181962221673
  981. Unicorn Girls Horse Large Inflatable Blow Up Toy 202517884308
  982. Eight Below NEW DVD Paul Walker 301636956303
  983. Google Pixel 2 XL Case Spigen Thin Fit 182854665743
  984. Bichon Frise Slim Calendar 2019 Dog Breed 283101319352
  985. Suzuki GSX250 ETEX GJ51B 80 82 DID GOLD VX2 292758341813
  986. Reliance Pressure Reducing Valve 1 2 in BSP Female 323578692046
  987. 8KW 12V Air diesel Heater 4 Holes 4 282972190900
  988. EBC GD Rear Brake Discs 300mm for BMW 273063346067
  989. Xiaomi Mi 6x Redmi Note 4x Hot Mirror 323272410946
  990. Unknown Artist Puccini La Boheme Orch et 301652969590
  991. For Huawei Mate 20 Pro TPU Clear Case 413683368854
  992. steel wheels VW Golf IV Variant 1J 195 65 123540576026
  993. Glass Magic Lantern Slide DREAMS OF PARADISE NO6 362509090949
  994. Kawasaki ZX9R E 00 01 SP Engineering Polished Stainless 283048254417
  995. Christmas Nail Art Stamping Plate Snowflake Noel Stamp 641309029386
  996. joblot of boss dn25 ball valves with yellow 323612570294
  997. Oxford Students Thesaurus By Oxford Dictionaries 292467473647
  998. Pro Bolt Ti Caliper Pin Tokico Race x4 Gold 302699781109
  999. MITSUBISHI GALANT 1992 1996 E50 Saloon Swan Towbar with 191923047965
  1000. The Illustrated History of Manchester United 1878 1999 Tom Tyrrell 392094147595
  1001. Life Size Tyrannosaurus Rex T Rex Dinosaur Tooth 153022091982
  1002. used landrover wheels and tyres 233015292645
  1003. La plume de lange by Bazire Laure Talamon 163442066180
  1004. Honeywell D04FM 1 2ZC Compact Adjustable Pressure Reducing Valve 332938164272
  1005. Olympus 2GB M xD Picture Card With Case 372506146470
  1006. 26 Retro Underskirt 50s Swing Vintage Petticoat Fancy 111720610520
  1007. 4x Vauxhall Astra MK4 20 SRI Turbo Genuine 302039259892
  1008. Motorcycle 2013 Yamaha YZF R6 600 RMSTATOR Voltage 302671164324
  1009. vw93 For VW Golf 20 TDI 13 18 Mintex 372452747037
  1010. 1979 1980 1981 1982 1983 1984 Commemorative Presentation 670443531018
  1011. Suzuki RV 125 K9 Van Van 2009 125 361211981566
  1012. Clear Cast Acrylic Perspex Sheet Cut To Size 461507093508
  1013. 156 Laptop LCD Screen LED 40 Pins PACKARD 163389435359
  1014. Fisher Controls Inlet Pressure Valve Type 67 Af 401621362966
  1015. New Mens Superdry Jackets Selection Various Styles 591592008807
  1016. Alloy Wheel Psw Nevada Matt Anthracite 16 65J 382660709377
  1017. Blue 5 Seats Auto Seat Cover Set Car 283295337427
  1018. Riding the Storm 3 Dolphin Diaries by Baglio 142695118345
  1019. Direct Fit Replacement Catalytic Converter for Mazda 323 323054554999
  1020. Skoda Rapid 16 Tdi Diesel 2013 2014 152811605387
  1021. Genuine Volvo XC90 14 Rubber Floor Mats Brown 362503763501
  1022. 1856 Seated Liberty Silver Dime Full Liberty Small 122251637483
  1023. Cometic Engine Gasket Top End Kit KAWI 323520566125
  1024. WIESBADEN GERMANY Street Sign German flag city country 181723128558
  1025. Romeo I Julia Romeo Juliet Blu Ray 301799097201
  1026. Rexroth Zdr 6 Da3 40 75Y Pressure Reducing Valve 401621367386
  1027. Reservoir Dogs DVD 2006 183380399757
  1028. 1 50pcs Gypsophila Artificial Fake Flower Plant Bouquet Home 132653796558
  1029. PROXXON 28510 Bohr und Fr%C3%A4sger%C3%A4t MICROMOT 50 E mit 192704627384
  1030. Tarox G88 Front Solid Brake Discs for Fiat 232877724969
  1031. JT Front Sprocket 16T Rubber Dampener Kawasaki 401576198751
  1032. Portable Anti slip Bath Soap Case Travel Hiking Camping 690892426100
  1033. FIT SYM Fiddle 50 9905 EBC Plain 401309198673
  1034. Premium Rear Brake Drums Pair for Ford Escort 291813020060
  1035. Genuine Canon Black Ink Cartridge for Canon Pixma 352188604289
  1036. Murano glass mirror 1940s 142950316567
  1037. New Red HP 15 AF013UR Laptop Screen Case Top 253646869845
  1038. BMW K 75 RT 1995 Ipone 104 10w40 131515690449
  1039. Alloy Wheel Mak Koln Silver 19 80J 5X112 253868905503
  1040. Fully Tailored Luxury Car Mats Toyota AVENSIS Estate 163426335211
  1041. BLUEPRINT ADD67301 TENSIONER KIT fit DAIHATSU PIAGGIO 401350210745
  1042. David Hedison in Voyage to the Bottom of 192606575394
  1043. Genuine Oe Valeo 3 Piece Clutch Kit For 152585353853
  1044. Chattering Chomping Teeth Wind Up Joke Funny Prank 173498594473
  1045. 2016 Beatrix Potter Royal Mint 50p Album Full 264080707800
  1046. DID Gold X Ring Drive Chain 520VX2 98 201670014469
  1047. ICUT60 Air Plasma Cutter Inverter Digital Display 161877697594
  1048. VINTAGE ORDNANCE SURVEY 1 MAP Market Weighton 273626189016
  1049. ARSENAL FOOTBALL SHIRT NIKE AWAY KIT 2007 2008 HERBERT 401663597019
  1050. 2 x Heavy Duty SOLID BRASS Door Butt 490785872205
  1051. 7 x Seahorse Guitar Picks Pendants GP00017825 223164872968
  1052. Novelty Eraser Rubber Party Bag Fillers Kids Stationary 584043327540
  1053. Mini Cartoon Flip Closing Lid Table Trash Can 601661057935
  1054. 100 Pure Beeswax Pyramid Candles 392178134889
  1055. Royal Doulton Crystal Daily Mail Offer white wine 143012313810
  1056. Moto Guzzi 750 Nevada Classic 750 ie 2006 262287560074
  1057. The Help by Stockett Kathryn 122831849849
  1058. 2Ply Blue And White Rolls Embossed Centre Feed 572282382968
  1059. Ultimate Weapon by Ryan Chris Paperback Book The 302757945416
  1060. spare wheel spare Seat Leon from 2013 152979909860
  1061. 110Pc Pro Tap And Die Set Metric Wrench 111792834246
  1062. Hugo Boss Deep Red 50ml EDP Spray 253211865819
  1063. Gerhard Heinz The Erotic World Of Gerhard 292868403085
  1064. The V Disc Recordings by Louis Jordan Best of 372528753930
  1065. VW VOLKSWAGEN New BEETLE CONVERTIBLE 02 10 19 TDi 162739785725
  1066. 3X2X 35W D2S D2C Xenon HID White Headlight Light 123319016006
  1067. 12V 8mm Metal LED Indicator Light Car Boat 461904373629
  1068. 2017 Women Winter Slim Down Cotton Coat Long 162685821132
  1069. Yash Raj %E2%9D%A4%EF%B8%8F DIL BOLE HADIPPA SHAHID 153314799507
  1070. 1 House Plant in Ceramic Black Tall Tubus 690577392972
  1071. For Samsung Galaxy A8 2018 Plus PU Leather 441986261410
  1072. New Mens Rivet Faded Seam Black Genuine Leather 462516818663
  1073. Sin City A Dame to Kill For Movie 172618171621
  1074. Womens Ladies Guilty Designer Casual Top 471965518513
  1075. Barbie Iron on T Shirt heat Transfer diy 541082524553
  1076. Jack Hammer Compactor Rammer Plate Tamper Packer Concrete 330917428904
  1077. YAMAHA Pin Float 537 14186 00 Fowlers Parts OEM 362502182595
  1078. Star collection by Klaus Lage CD 163451285164
  1079. Isle of Man Railways Tramways special sheet mnh Trains 112948979549
  1080. Steel Heater Block Assembly Set Extruder Hot End 223016488584
  1081. Thunderpants 2002 DVD 153019046077
  1082. Fuel Pump for VW MULTIVAN T5 19 03 09 312028718126
  1083. Banjo Thumb Finger Acoustic Nail Celluloid Jim Guitar 591605994884
  1084. The Buckinghamshire Log Holder Firewood Rack Log Basket 263088384889
  1085. 18 19 Football Soccer Kits Adult Kids Club Jersey 492789694598
  1086. Serck Auxiliary Water Pump for Audi A4 19 323059445241
  1087. Hycote Ford Medium Steel Blue Metallic 150ml Double 182327079607
  1088. SKYRICH LITHIUM BATTERY 12V 20Ah PIAGGIO VESPA LX 273563946357
  1089. Keeway Matrix 50 pre 2008 70 301607253500
  1090. DID JT X Ring Chain Kit 16t 38t 191944330093
  1091. Jack Hammer Flexible Lino Tile Floor Scraper 290772101112
  1092. grundl Baby Color Double Knitting Yarn Shade 4 202395037658
  1093. Ve718039 Coolant Temperature Sensor For Opel Kadett 18 152933939927
  1094. 730314 6NW009228 Turbo Electric Actuator For VW Touareg 283317085949
  1095. Volkswagen Golf MK7 12 TSI 1112 4 Lines 152945117471
  1096. Joe Jackson Live At Rockpalast 2 292886232471
  1097. Personalised Blue Baby Boy Elephant Clothing New Baby 540863101693
  1098. Old Ordnance Survey Maps West Hartlepool Durham 1914 312116036537
  1099. For Bmw 3 Series E36 Z3 E36 142838669015
  1100. Star Wars Storm Trooper Giant XL Section 560206743822
  1101. FMF Racing Megabomb Header 43341 332466898215
  1102. Bilstein B4 Front Shock Absorber Mercedes Sprinter 5 T 122199739607
  1103. Heavy Solid Brass Vintage Old Georgian Style Rim 201440773859
  1104. Queen Jazz Cd Album 2011 Digital Remaster 391120337992
  1105. BIG BORE 70cc CYLINDER BARREL KIT HEAD for 362502248287
  1106. Gilera Nexus 125 2007 Athena Valve Cover Gasket 302688854728
  1107. Cosplay Costume Fairy Costume Halloween Gift Butterfly Wing 153258809573
  1108. Telescopic Fishing Rod Reel Set Sea Fishing 492785776455
  1109. Toyota High Quality Spray Paint Kit 393 Bronze 372468094924
  1110. 2017 Sir Issac Newton Fifty pence Coin 50p 253883334757
  1111. 400W Wind Turbine Generator DC 12V Controller 282454922791
  1112. Pack Of 8 White Radiator Sleeves Pipe Covers 252968844544
  1113. X1 Magic Little Tree 2D Hanging Air 123562445080
  1114. Salad Herb SpinnerStrainer Colander Lettuce CutterChopper Small 263321478670
  1115. Elton John The Very Best Of Original Double 323610728902
  1116. Atmosphere %E2%80%93 When Life Gives You Lemons You 113327089756
  1117. Vintage 1950s 60s Punch and Judy Hand 183592710081
  1118. THUNDERCATS HO 1 inch 25mm Button 221149085480
  1119. Mens Skechers Leather Comfort Fit Memory Foam Walking 563484232758
  1120. Gold Tone over Sterling Silver Created Blue Sapphire 361997611522
  1121. Good Lucky A Book of Poems Puffin poetry Paperback McGough 362456191935
  1122. 2007 2009 Suzuki RMZ250 Dirt Bike All Balls Swing 192562039115
  1123. JAMES LEVY AND THE BLOOD RED ROSE Pray To 262672197422
  1124. Old sack barrow 192770486004
  1125. Beautiful Stylish Crushed Velvet Ottoman Box Storage Box 423741488928
  1126. Argos Home Arizona Corner Solid Pine TV Unit 352461074626
  1127. New Anti Mosquito Bug Wrist Band Insect Nets 562843453070
  1128. Peugeot Ludix Trend 50cc Hardened Exhaust Stud and 132772554993
  1129. Luxury Leather Flip Wallet Magnetic Case Cover For 690535825106
  1130. 150Wh Portable Solar Panel Generator Power Supply Energy 152944213789
  1131. Tibetan Buddhism Amulet Copper Golden winged Bird Pendant Home 183325595522
  1132. Heavy Duty Cotton Lined Full Car Cover For 123464461254
  1133. Genuine For Asus 90XB00DN MPW000 Laptop 120W AC Adapter 332196916527
  1134. Battery for HP 2000 299WM 2000 300CA 2000 314NR 2000 320CA Laptop 182934907843
  1135. UK Women Lady Mid Kitten Heel Pumps Pointed 112756356528
  1136. UK Fashion Women Cold Shoulder Turtleneck Blouse Geometric 690908233179
  1137. 1943 Walking Liberty Silver Half Dollar ngc Certified 273625706622
  1138. Vogue Magazine Cover Print Poster Wall Art A3 553125108357
  1139. Sinatra Frank Playlist The Very Best of 382401615155
  1140. Mercedes Cla w117 Carbon Rear Spoiler Lip Hard 253972469763
  1141. Anh%C3%A4ngerkupplung abnehmbar Opel Combo C 2002 2012 13 pol 182593189269
  1142. 110Pc Tungsten Jumbo Tap and Die Set Kit 262085212945
  1143. Valve Cover Gasket Suzuki GS 550 263157823164
  1144. Quilted Dog Pet Rear Seat Cover With Side 323548673874
  1145. Black 35mm CNC Clip ON Handle bars HANDLEBAR for 113325243072
  1146. Newsham Gavin 2010 FIFA World Cup South Africa 352402150069
  1147. Sitta Rear Sprocket 45T 530P Aluminium Black Triumph 302890440606
  1148. 12V 2A AC DC Adapter Charger Power 263948238246
  1149. CLEO by PANACHE Lucille Bandeau Bikini Top Strawberry 591316612123
  1150. LOVE HEART INITIAL LETTER Keyring Special Friend Birthday 485147433496
  1151. UK New Gel Polish Remover Machine Nail Art 202517879621
  1152. 2017 Winter Women Down Cotton Long Slim Coat 621567830469
  1153. New SPRAY GUN WAND 5 in 1 NOZZLE SURFACE 273341520412
  1154. 1 BMW Alufelge Styling 385 8Jx18 ET52 6796213 263872474274
  1155. Thwaites Alldig 100 backhoe loader digger excavator dumper 163037945631
  1156. Rustic Cream Hand Crafted Guardian Angels Ornament Figurine 502374839620
  1157. Car Pin Up Retro metal Aluminium Sign vintage 323542064263
  1158. Richard Kirk H Dasein Vinyl LP 2 113025827381
  1159. White Black Thanksgiving Quote Jumbo Fridge Magnet 183239255909
  1160. Stockport County 1998 99 Soccer Yearbook Superteams Hardback Book 142996829484
  1161. Original Eagle Jet Torch Gun Adjustable Windproof 231154193740
  1162. i TO FIT HYMER 2009 MOTORHOME SEAT COVERS TAN 382219764370
  1163. PHIL COLLINS NO JACKET REQUIRED CD Album 222856175147
  1164. 13 MM CERTIFIED Round Champagne Color VS 100 132894475306
  1165. F BOX WHOLESALE x 36 CARS 3 192746120143
  1166. 4GB RAM Memory Toshiba Satellite L745D PSK16U 00GTM1 DDR3 12800 292701835294
  1167. Aprilia SXV 45 2008 13 Metzeler Sportec M5 Interact 302118911476
  1168. Star Wars Mens The Last Jedi Kylo Ren 583693870865
  1169. New HP Compaq 15 G035ST Notebook LCD Screen Back Rear 192208233225
  1170. Monroe Rear Right Left Reflex Shock Absorber x2 372452218711
  1171. Bendix Ben 066 Mf 125 Mito 01 2001 Front Caliper 281691787029
  1172. New Audi A4 B7 19 TDI Genuine Mintex 362396969157
  1173. JMT Lithium Ion Battery YTX7A FP For Rex Milano 332612234666
  1174. RG Radiator Guard Kawasaki ZX10 R 2010 RAD0068GR 401385961844
  1175. Yamaha Yzf R3 300 Oem Rear Abs Speedo 262807735305
  1176. Ellas Kitchen The First Foods Book The Purple 362515651841
  1177. Engineering Tap And Die Set Heat Treated Polished 201153654144
  1178. Ladies Batgirl Supergirl Wonder Woman Robin Hero Fancy 420195668874
  1179. Pogi s Poop Bags 50rolls 750 Bags 392170054066
  1180. BATTERY 4400mAh for Asus X93SM YZ018V X93SM YZ055V X93SM YZ057V 362321577842
  1181. 11 12 2010 Aston Villa v West Bromwich Albion 372515823187
  1182. Opera by Richards Halter Neck Black Evening Dress 223291182524
  1183. Official Manchester City FC Annual 2014 Annuals 2014 291651770611
  1184. New Suzuki VZR 1800 K9 M1800R Int 09 113274227994
  1185. Luxury Womens Stainless Steel Watch Printed Mermaid Quartz 153123936943
  1186. Yamaha YFM 660 FS Grizzly 2004 Ipone Katana 131512494683
  1187. Serck Auxiliary Water Pump for Audi A6 28 332547064341
  1188. Resin Wagon Load For Hornby Oo Gauge 472341193535
  1189. Belle BMD300 Mini Dumper 4x4 All Terrain Power 192350492375
  1190. Unicorn Diamond Mermaid Make Up Brushes Set Powder 492347612699
  1191. key fob keyless remote transmitter Ford F550 2007 223043729513
  1192. Ravel Grayling Suede Zip Up Ankle Boots In 601833517113
  1193. Douk Audio TAS5613 Digital Amplifier 21 Channel Subwoofer 282127243983
  1194. JOHNS 90 06 10 6 HAUPTSCHEINWERFER H7 rechts 272707448176
  1195. Linhof 4x5 Super Technika V Large Format Camera Rollex 401450334961
  1196. Kids Baby Flower Girls Party Sequins Dress Wedding 572180115488
  1197. Heavy Duty Natural Coconut Coir Reception Entrance Door 423085208909
  1198. Smetana Trio Maurice Ravel Piano Trio in 173607849899
  1199. All Balls Front Fork Oil Seal Dust 332839710548
  1200. No Toil NEW Mx Kawasaki KX125 94 05 KX250 283148088188
  1201. Hair Bun Maker Donut Styling Bands Former Foam 661028312339
  1202. Dewalt Dt7969 Screwdriver Bit Set 32 Piece Impact 261982284217
  1203. germany mint private courier stamps block ref 10213 401670949138
  1204. Adult Harlequin Honey Costume Ladies Jester Clown Halloween 453040066356
  1205. Pro Bolt TI Heel Plate Bolt Kit Black 302732935742
  1206. DUCATI MONSTER 695 Exhaust MIVV X cone 2006 2008 123531310987
  1207. EBC Front Brake Kit Discs Pads for 292478220665
  1208. King of the Hill Season 1 2 143049079570
  1209. 18 1012 Suzuki GSF600S Bandit 1996 1999 Front Brake Master 232223327596
  1210. 50FT 100FT 200FT EXPANDABLE FLEXIBLE GARDEN HOSE PIPE 263061274420
  1211. steel wheels OPEL Astra Sports Tourer P J SW 215 60 273605617049
  1212. FILTER OIL HIFLOFILTRO HF197 Hyosung MS3 250 2006 263926275090
  1213. Star Shape Stickers For School Children Teacher Reward 432031098566
  1214. PS3 Tekken Hybrid 2011 Brand New Factory 273480345081
  1215. Renthal Grooved Twinring Rear Sprocket 48T Orange For 192646352017
  1216. Brass Crumb Tray 254029731716
  1217. Watercolour Less Is More Quote Jumbo Fridge Magnet 183239259370
  1218. ONEXAdjustable Speed Skipping Rope Boxing Crossfit Training Gym 183015676604
  1219. Various Wunschkonzert der Volksmusik CD 382502613426
  1220. VAUXHALL ASTRA SRI XP Blue Manual Petrol 2009 113412177502
  1221. WPC Wood Composite Plastic Decking Boards 150mm x 142455243763
  1222. Femac TE60lt Flail Head For 15 30 172831002722
  1223. Honda Civic VII 20 Type R EP3 K20A2 201584845904
  1224. New Hauck Caviar Neon Rapid 4 Pushchair 142607901950
  1225. Genuine Briggs Stratton 262753 690347 Air 230925971780
  1226. original vhbw%C2%AE AKKU 108V 4400mAh SCHWARZ f%C3%BCr Toshiba 192075740423
  1227. Oem 2014 2015 2016 Kia Soul Lh Driver 372250066206
  1228. Very Good War and Peace A Collection 123260790887
  1229. VANITY FAIR SPY CARTOON John Henry Puleston Devonport 272597653939
  1230. 925 Sterling Silver Clear Pink CZ Tiny Baby 264043983954
  1231. Coolant Thermostat Temperature Monitor Audi Seat VW Citroen 253460454427
  1232. 2xLED T10 501 Canbus 5x5050 SMD Fits Boot 352474609185
  1233. Hop by Root Phyllis Hardback Book The Cheap 392114893934
  1234. Temperature Switch Radiator Fan For Peugeot 405 332399015914
  1235. Hitachi ZX135 3 Excavator 13 Ton Digger Zaxis 130 391994255222
  1236. Frankenstein Vintage Magic Shelley Mary Very Good Book 192724144420
  1237. Wireless Bluetooth Over Ear Headphones Earphones Headset for Pad Tablet Phone 472343844421
  1238. Kitchen LED Light Under Cabinet Shelf Cupboard Round 292600157383
  1239. Jason Dufner SIGNED 10x8 FRAMED Photo mount Autograph 123319199880
  1240. VW GOLF 2008 2012 VI 5K Hatchback 3 5d Detachable 201667789039
  1241. Byron Sentry BY102 60m Wireless Plug In Door Chime 223093531612
  1242. Samsung Galaxy Tab A 7 SM T280 WIFI LCD 273607094241
  1243. New Honda Cbr 600 Rr De 2013 Dark 251998590954
  1244. 120 70 17 Maxxis DIAMOND MA 3DS YAMAHA YZF 750 R 123558573976
  1245. 100w Super White Xenon HID Upgrade Low Dip 192270893848
  1246. Jcb 3cx Sitemaster Extra Dig 5 Buckets Pallet 292793247850
  1247. Nigel Mansell SIGNED Framed LARGE Square Photo Autograph 382384328855
  1248. Cute Multicolor Satin Ribbon Bow Hair Band Scrunchie 351151166148
  1249. Xscape NEW Blue Womens USA Size 6 Lace 143062758337
  1250. Goebel Camel Lying for Large M I Hummel 371623535876
  1251. Various Artists Hits Of The 80s 302996820134
  1252. ALLOY WHEEL MAK SPECIALE MERCEDES E KLASSE CABRIO 85x21 382441741540
  1253. Audi A5 8T Sportback 5 Door Rear Right 282764168166
  1254. Renault Clio MK4 2009 Rubber Tailored Car Mats 431467945389
  1255. Works Triplestar Rear Alum Sprocket Black 50T OFFROAD 322479508331
  1256. les PLAGES BELGES Rf796 VINTAGE POSTER REPRINT 40x60cm 157x236 153260226573
  1257. Turbine Wind Generator 300W Dc12V 6 Blades Max 222284393823
  1258. Elizabeth Arden Prevage Anti Aging Daily Serum 50 ml 183523758764
  1259. Battle of the Bulge Midway DVD 302950453013
  1260. La plume de lange by Bazire Laure Talamon 163399723983
  1261. American Graffiti Soundtrack Original MCA 2 Disc Fatbox 173699202801
  1262. NEW RYA Intermediate Windsurfing Paperback 1905104588 361899685064
  1263. Fran%C3%A7oise Hardy Le Meilleur De Francoise Hardy 381317061585
  1264. kit chain front rear sprocket PBR 112811701348
  1265. 1X4 Way RCA Audio Video AV Switch Box 382676614119
  1266. Wizards of Waverly Place The Movie DVD 2009 292827996070
  1267. BRAND NEW SAMSUNG GALAXY S4 Mini 8GB Unlocked 253891468687
  1268. Vintage John Wilman Shalimar Pre Pasted Vinyl Coloroll 273599781061
  1269. RED SONJA 14 JG Jones Cover Dynamite 2005 192202025485
  1270. For Kawasaki KLF 220 A9 Oil Filter 1996 121817095474
  1271. New PROX YZF 450 10 13 Steel Exhaust Valves 172533169487
  1272. S925 Sterling Silver Stud Earrings Daisy Sun Flower 323421611398
  1273. 3D ArtAnon 132687895069
  1274. 12V 500 Watt Wind Generator Turbine IstaBreeze 400514900062
  1275. EG Lots 20PCS Foils Finger Nail Art Sticker 173072646935
  1276. Magic Lantern Coloured Glass Slides Queen Victoria Coronation 202517852264
  1277. House Next Door by Siddons Anne Rivers Paperback 302131436636
  1278. Official Liverpool Football Home Shirt 2018 19 Mens Jersey 541775488357
  1279. Bm90149H Catalytic Converter Approved Petrol Cat 292160780526
  1280. Mens Padded Lined Lumberjack Shirt Mens Blue Castle 660933275155
  1281. Pvc Table Cloth Modern Grey Scale Circles Stripes 291794347520
  1282. Doctor Who The New Series 1 301831048932
  1283. DID X Ring Chain 530 96 with 222432554789
  1284. Women Sexy Halter Tie Lingerie Set Floral Lace 690762958092
  1285. LifeProof Fre Waterproof Case for iPhone 5 173706336716
  1286. Turbine Wind Generator 300W Dc12V Steadily 6 Blades 252511029867
  1287. Brand New Ex MS Marks Spencer Cotton 641318812200
  1288. Iron Maiden Resin Kit Statue 223267474185
  1289. Fruit Fly Culture Extra Large Flightless Hydei Melanogaster 552256512308
  1290. Magazi Stainles bar end chrome black mirrors 352503327801
  1291. Special Manchester United Third Shirt 2008 XL Nike 292872964514
  1292. 999%E2%80%9D Silver Russian Soviet Military Order Patriotic War 292313279462
  1293. 360%C2%B0 Rotating Stand Wallet Leather Case Cover For 253914024068
  1294. Piston Kit Standard Bore 6637mm 1992 Kawasaki KX250 Namura 132850866761
  1295. Picture Postcard Scilly Isles St Marys Tooth Rocks Friths 292871147618
  1296. Mamas and Papas Maternity Wrap Around Dress Size 264004582999
  1297. Chain Saw Blade Disc 125mm x 22 x 182748053759
  1298. Brake Pads Front for CITROEN C6 30 CHOICE1 2 312009208131
  1299. Giorgio Armani Acqua Di Gio 30ml Eau De 352438628784
  1300. VW GLOSS BLACK REAR BOOT BADGE EMBLEM LOGO 282491539266
  1301. Yamaha Thumper XT500 TT500 Stainless C Hook Spanner 150828327498
  1302. 10 Styles Ceramic Glaze Incense Smoke Cone Burner 232977953665
  1303. Vauxhall Tigra Twintop 13 Cdti 2 Piece Clutch 401221747777
  1304. steel wheels MITSUBISHI Outlander CU0W 205 60 R16 92H 273605267402
  1305. 2773101 Cinghia Trasmissione Mitsuboshi Per Aprilia Scarabeo 382370679630
  1306. Freespirit Discover Ladies Hybrid Bike Bicycle 16 Frame 163429263976
  1307. Stapleford NG9 Bottle Opener Postcode Place Gift 163420928473
  1308. Led 18mm Div Mod Type Colours Clear 453115153232
  1309. NEW 6PC Schott Zwiesel TASTE 264 oz Red 123535807034
  1310. Loose natural clarity enhanced diamond round 030 ct 322434992135
  1311. steel wheels VW Tiguan 5N 215 65 R16 98H 132243392498
  1312. Volvo S40 V40 2000 2004 Charcoal 583519591785
  1313. VAR690 Back Rear Wiper Blade Mercedes Benz M Class Ml 352311288977
  1314. Car Cover Fitted Indoor Outdoor Voyager for Peugeot 273366493936
  1315. 3x5 5x7ft Colorful Ray Vinyl Photography Backdrops Party Background 263540863992
  1316. Suzuki SX4 S Cross 2013 Thick Luxury Black Car 502158670028
  1317. High Quality WHITE Linen Look Tablecloth 100Polyester 484916908891
  1318. Terex 1 Ton HD1000 Hi Tip Dumper Skip Truck 392070102671
  1319. Brake Disc Pads Front R H Kyoto for 1992 321859531013
  1320. Funko POP Vinyl Kratos Gamestop Exclusive And NYCC 123417962920
  1321. 800 Cts 20X13 Mm 100 Natural Dendrite Opal 283279359578
  1322. Renault Logan 16 Genuine Delphi Front Left Lower 301956088123
  1323. Oil Pastels by Pentel Artists Pastels Pack 121358404858
  1324. SEALED War Room DVD NEW 2015 Alex 202544746341
  1325. Alfani NEW Blue Mens USA XL Printed Roll Tab Sleeve 143056014305
  1326. LED Floodlight Motion Sensor PIR 20 50 100W Security Light 462707816318
  1327. SPAIN Scene at the Battle of Campillo de 352226231538
  1328. Fork Dust Seals for 1986 Suzuki GSX 1100 323185049732
  1329. Vintage BELLE AIRE 70s 80s Dress Ruff Frilly 163450552153
  1330. 150Wh Solar Power Generator Portable Supply Bank Energy 123148295069
  1331. Rod Strut stabiliser FAI AutoParts SS5955 183373059897
  1332. Stand Sharp Lc 40Cfe6242E Lc 43Cfe6241E Lc 43Cfe6242E Cl 49Cfe6241E Tv 263143789119
  1333. Greek Bouzouki Dance by Sites Sounds of 163409303931
  1334. Motion Pro Polished Cast Brake Right Lever for 192645640991
  1335. Yamaha YZ 125 2T USA 1999 2014 Wheel Oil 112265167233
  1336. Duracell 377 SR626SW AG4 SR66 15V Silver Oxide 331979764507
  1337. Vintage Indian Saree 100 Pure Silk Printed Antique 352552538732
  1338. VW Polo 6R 14 Genuine Nissens Engine Cooling 301978056853
  1339. EBC Front Brake Kit Discs Pads for Skoda 292479206014
  1340. Nintendo Wii SpongeBobs atlantisches Abenteuer Atlantis Squarepantis 372538646579
  1341. Fixed Flange towbar 7pin Wiring for Fiat 251988048282
  1342. Acer TravelMate 4740Z P606G32MN New Genuine Delta 90W AC 331252840659
  1343. Suzuki Gsxr 750 Gr77A 88 89 Cam Shaft Rocket 322569719643
  1344. Monsoon Size 14 Floral Lace Dress Turquoise Blue 264075139293
  1345. Final Touch 100 Lead free Crystal WHISKY GLASSES Drinking 670909829850
  1346. Pack 10 Large Gem 25Mm Blossoms For Cards 461809878341
  1347. OFFICIAL WWE 2018 HELL IN A CELL HARD 302882764628
  1348. Jcb 805B 221546715905
  1349. Kino International Brk20141 Hard Day Blu Ray 2014 ws 235 korean english Sub 253973043122
  1350. For Hyundai Tucson Jm 20 2004 2010 New Direct 291226160124
  1351. Retro Adidas Arsenal JVC Football Shirt Size 42 44 153303441472
  1352. Yamaha TZR 50 1996 Organic P Front Disc 130867412283
  1353. Tamiya 35192 US Army Assault Infantry Set 252934511683
  1354. Yamaha FZ1 1000 NA ABS 2015 Lithium Ion Motorcycle 141908245221
  1355. Maglia SSc NAPOLI Kappa Kombat Karbon 2018 Extra 112669984035
  1356. Rover High Quality Spray Paint Kit 965RD Tahiti 372468093747
  1357. Beast Quest Series 5 Pack 6 books RRP 182583393422
  1358. Vtg CHOKIN ART PLATE 24KT GOLD 9 1 4 273591376196
  1359. 4PCS Set Speed Out Screw Extractor Drill Bits 282681725300
  1360. 3Axis Dro Mill Lathe Digital Readout Display 252062302316
  1361. Honda Cbf1000 Cbf 1000 Non Abs Stainless Braided 381300845436
  1362. Love Heart Crocheting Personalised Keyring 181755232722
  1363. Women High Block Heels Ankle Boots Pull On 572992476577
  1364. Geza Anda Edvard Grieg Grieg Peer Gynt 292888644514
  1365. Love Quote Valentines Day Anniversary Birthday 572251922575
  1366. Vintage Retro ORIGINAL Knitting Pattern PATONS 8145 LADIES 332934525712
  1367. My Neighbor Totoro Studio Ghibli inspired Mens Printed 560194839451
  1368. BMW 4 Series F32 F33 13 17 LED DRL 123339794138
  1369. Fun on the Farm Little Groovers by Sophie 302402340008
  1370. RK OE Chain Sprocket Kit For Honda 142920348383
  1371. Pandora September Birthstone Signature Heart Charm Ref 791784Ssa 372526748447
  1372. Inclinometer Gauge Angle Protractor Slope meter Level tilt 122062444753
  1373. Fashion Mens Sport Athletic Soccer Football Fitness Training 690580557888
  1374. Sinfonie D Moll Metamorphosen by O Suitner 163398528061
  1375. DC ComIcs The Curse of Brimstone 1 202544200735
  1376. 4Pcs Pom Ball Marker Fluff Ball Weaver Knitting 382630483259
  1377. Acer Aspire R5 571TG 56WH R5 571TG 765T V3 572PG 56CY Laptop Netzteil AC 163158060072
  1378. Mens Boys All In One Fleece Jumpsuit Pyjamas Hood 651297105624
  1379. DIY Wall Clocks Spindle Quartz Hands Movement Repair 401622613728
  1380. Equilibrium Silver Plated Sentiment Message Bangle Bracelet Birthday 491982957729
  1381. Xmas gift Funko POP Marvel series Movie game 671392099629
  1382. New RAINCOVER PVC Zipped to fit Mothercare Orb 254030689807
  1383. Tremolo Harmonica Metal 24 Holes With Case Mouth 573024729837
  1384. Coin capsules ULTRA inner diameter 17 mm 311963017691
  1385. Womens Ladies Skull Rivet Handbag Cross body Shoulder 323569430680
  1386. Mini small home vertical axis wind turbine generator 152773560101
  1387. GFT GRIMM FAIRY TALES 109 BEOWULF Cover C 152466808101
  1388. VonHaus Household Safe 425L 273557976780
  1389. Island World Book Day 2017 Almond David Very 322669713181
  1390. 4 UK Sea Life Tickets Book Any 283307923132
  1391. Fantastic Stories by Terry Jones Hardback 264091190740
  1392. Crushman micro crusher concrete brick Mini digger trailer 183110739617
  1393. Wii %E2%9C%94 SUMMER SPORTS PARADISE ISLAND DDR HOTTEST 123471379675
  1394. XTREME Traffic Film Remover TFR Snow 112928759177
  1395. TONY BENNETT PLAYIN WITH MY FRIENDS BENNETT 162228903459
  1396. Heavy Duty Mesh Headrest Pet Dog Guard For 273013776528
  1397. UK Soft Comfort Wrist Gel Rest Support Mat 253826693241
  1398. 3in1 Black Quilt Pet Seat Cover Dog Protector 123363372387
  1399. Ultrasonic Mouse Mice Rat Spider Bug Pest Repeller 262463881491
  1400. Liquid Dynamic Quicksand 3D Unicorn Case Soft TPU 423910515198
  1401. Palace brothers and Bonnie price Billy albums Job 292877520600
  1402. PS4 Official Wireless DualShock Gamepad Controller Joystick Consol 492868144266
  1403. Sixity Organic Brake Pads FA92 Rear Replacement 152979185945
  1404. New Womens Glitter Purse Girls Designer Style Wallet 173006028683
  1405. 3XIRIN 21 inch guitar ukulele soprano Hawaii 4 123302519195
  1406. Ultra Deck screener Screen Crusher Trommel Mini Digger 391852410024
  1407. 2X 35W D1S HID Xenon Bulbs Car Headlamp 424119303408
  1408. JT Rear Sprocket JTR486 44 Teeth 222436068316
  1409. Honda CB 500 XA ABS 2017 JMT Lithium 362468484805
  1410. Planet Jazz by Gerry Mulligan CD 163409300364
  1411. 17 10 1964 Blackpool v Everton Creased No obvious 372516753117
  1412. The Teaching of Science in Primary Schools Wynne Harlen 332745461118
  1413. Dr Martens Youth Dark Pink Glitter 1460 Boots 283091624424
  1414. Job Lot JobLot Collection Bundle of Chic Romance 382622195997
  1415. VW EOS 1F8 20 FSI Genuine Intermotor Rear 361508558008
  1416. Universal Rotates 360%C2%B0CCD HD Car reversing Camera Reverse 253992262383
  1417. Disney CARS 3 Blind Bags Mini 651085996145
  1418. Donnie Brasco by JosephD Pistone Book The Cheap 302754155275
  1419. Komatsu PC 26 Mini Digger 3 Buckets included 123219964435
  1420. Leeds United UTD 2012 2013 Home Football Shirt 123522876939
  1421. Trasmission kit chain and front rear sprocket 142688144416
  1422. Hm Short Sleeve Open 362517565559
  1423. Vintage Nokia 106 RM962 Mobile Untested Retro Collectable 263736747603
  1424. Gooseneck Arm 360 Lazy Bed Desk Stand Holder 153148974245
  1425. Mirrors Left Right Hand for 2004 Honda 392120884814
  1426. Hazard Warning Switch Button Triangle For Audi A6 182739953862
  1427. Wholesale Lot Natural Gemstone Round Spacer Loose Beads 413307408307
  1428. UNF 5 16 Cap Head Socket Screw 129 High 541221390387
  1429. Rullo Scorri Catena Superiore Suzuki Rmx 250 1991 172767319325
  1430. Ultra Thin Slim Acrylic Hard Back Case Cover 423226734027
  1431. Personalised Best Teacher Gift Christmas Baubles Xmas Tree 502042617583
  1432. takeuchi tb1140 excavator digger 273202753833
  1433. Womens Ex NXT Vest Tank Top Soft Cotton 441986528463
  1434. UFE Speed Skipping Rope Jump Fitness Exercise Adult 302589908484
  1435. Saints Row The Third PS3 VideoGames 392199261612
  1436. HB Bildatlas Kykladen Griechische Inseln by B%C3%B6t 163402656983
  1437. SCHULZ NEW PAGES FOR ALBUM TYPE 431912303853
  1438. Jcb Front and Backhoe Shovel Loader 132763603309
  1439. Nike Air Max Sequent 2 Womens Sneaker Trainers 553334732379
  1440. Daelim VL 125 Daystar 2003 Front Goldfren S33 142856271383
  1441. Genuine Rear Wiper Arm Nut Cover Cap Fits 263688829156
  1442. YAMAHA RS 100 1Y8 Europe 80 82 EBC Heavy 400471781694
  1443. All Balls Fork Oil Seal Kit for Yamaha 113231831887
  1444. 28mm Antique Brass Complete Metal Ring Curtain Pole 152119773079
  1445. Nail art liner brush ultrathin line drawing pen 601834922633
  1446. Triple S 11 Tooth Front Sprocket Derbi 50 291881593724
  1447. Gavin And Stacey Series 1 to 3 Complete 263536040614
  1448. 361909 001 398876 001 DX532AV EG920AV Battery for HP Laptop 182934949436
  1449. Nikon AF S DX Nikkor 18 200mm f 35 56G IF ED VR 372442699854
  1450. Genset 300D8KVA generator welder 3 cylinder diesel 232725103652
  1451. Peugeot 400 Satelis Urban 2011 Super4 Oil and 262863670132
  1452. Windproof Lighter Turbo Jet Gas Cigar Cigarette Refillable 323081543083
  1453. Vintage Canon Japan Black Genuine Shoulder Neck Strap 312324015679
  1454. Gasket Set crank case ELRING 108317 183270881980
  1455. EBC Front Ultimax Discs Yellowstuff Pads Audi 232665866305
  1456. Usb Data Sync photo Transfer Cable Lead Nikon Coolpix 221717211431
  1457. Guitar Pick Holder Genuine Leather Plectrum Picks Case 661110600102
  1458. Hardwood Timber Kiln Dried Waney Edge Live 183344103588
  1459. North Face Ladies Down Filled Parka Dark Green 332960556609
  1460. King Albert By Whiting Sterling Silver Olive Spoon 142377182912
  1461. Vintage Ships Brass Engine Room Gauge Maritime Marine 253616180938
  1462. NEW The Shape of Things Paperback 0571212468 132089203638
  1463. Citro%C3%ABn Berlingo 16 HDi Box 75 74 Rear 123524706880
  1464. 01G 2KG Pocket Digital Scales Jewellery Gold Weighing Mini 221974334161
  1465. AS A Level Maths for AQA Statistics 1 401627377226
  1466. 20Pcs Garden Balcony Beautiful Vegetable Plants Multi color Tomato 583416270733
  1467. Oil Filter Triumph Sprint Executive 900 885cc Carb 401377743366
  1468. Polisport Front Motocross Number Plate Board KTM 362147806620
  1469. Bitube Set Rear Shock Absorbers Wmb02V2 Dark Edition 142965378066
  1470. Miniature Wood Plate dolls house farm 123125608124
  1471. Hollister Navy Blue Floral Skirt Size Small 372419301035
  1472. Tunable 440Hz A Tone Steel Tuning Fork Violin 192757930935
  1473. ALL 5 NEW Disney Cars 3 Mini 163202037536
  1474. Wooden Merry Go Round Carousel Music Box Kids Toys Gift 253805305790
  1475. VARIOUS ARTISTS Big Hits 99 2x CD 42 Track 312351468774
  1476. New Pair Extra Large Gold Or Silver Hoop 572443454717
  1477. Portable 150Wh Solar Power Generator Energy Storage Battery 323407401200
  1478. Left Hand Passenger Side WIDE ANGLE WING DOOR 142550621816
  1479. Word Definition Coffee Rainbow Quote Dinner Table Placemat 183238691319
  1480. Charles Bentley Bright Pop Up Play Tunnel Indoor 202378574705
  1481. 2004 09 Suzuki LT Z250 250 Quadsport REAR WHEEL 221780392706
  1482. 150 Heat Shrink Tube Sleeving Black Mixed Size 132752525688
  1483. Oil White Zinc Filter For Bmw R1150 131128983982
  1484. ESV Study Bible Trutone Chocolate rose Trail Design 392188953534
  1485. New VW Golf MK6 14 2799mm Diam Genuine 302641672475
  1486. Eragon Sony Psp Disc Only Free 283305453448
  1487. Samsung Galaxy S9 S9 TPU Case Cover 162951181748
  1488. Vanity Planet Palette Professional Make up Brush Set 15 Piece 282991206591
  1489. Garland GAL16SW Super 7 Self Watering Windowsill Propagator 132854390651
  1490. Oil Service Kit Honda VFR400 Pro Arm 87 89 MOTUL 123505554123
  1491. Wheel Spacers 3mm Pair of Spacer Shims 4x98 172336920702
  1492. UK 25Colors Women Winter Warm Cashmere Silk Solid 254009835006
  1493. 9055 100Pcs Organic Pepper Seeds Purple Chilli Seed 264040828991
  1494. Yellow Stitch M Stripe 2X Front Door Card 232553411175
  1495. Pair Of Vintage Brass Door Handles 123539398359
  1496. VW POLO 1994 2001 wipers Front 1919 and Rear 122540330802
  1497. GB Stamps 1967 QE II Machin Pre Decimal 233058865515
  1498. Anthony Horowitz The Diamond Brothers Collection 7 Titles 192260293935
  1499. CKCSNAME989 I CANT KEEP CALM IM A 231514102769
  1500. Melody Jane Dolls House Victorian Servant Maid Cook 382356532453
  1501. Lencrier du diable by Bazire Laure Talamon F 163447361889
  1502. VAUXHALL VIVARO ALL YEARS DELUXE RACING red VAN 122169760929
  1503. Xmas Alphabet LED Letter Lights Light Up Plastic 584054958568
  1504. Trunk Music Harry Bosch Series Paperback Connelly Michael 362515834983
  1505. Antique Print C1800s Engraving Race Horse Racing Horses 132856927555
  1506. 12mm ANGEL WINGS RING in Sterling Silver Plate 192171522026
  1507. BOSCH LAMBDA SENSOR No 258006827 392182446346
  1508. Vaico Coolant Expansion Tank Reservoir V10 2692 P New 153034920731
  1509. 2006 Jcb Js130 Groundworker 15 Ton Excavator Digger 352530470359
  1510. Motorhome Self drive hire 113449504984
  1511. Blue Camo Front Van Seat Covers Single Double 123009005867
  1512. United States 1982 Touro Synagogue FDC Unadressed VGC 401672605214
  1513. VW Caravelle MK5 20 TDI 4motion Variant1 Genuine 291778969706
  1514. UNION JACK Flagge BRITISCHE Fahne UK 50mm Vinyl 321015833633
  1515. National 2 Piece Clutch Kit CK10055 Fit with 323364746485
  1516. RED nylon Braided Bracelet Custom made Pandora you 401658096052
  1517. job lot of ephemera c25 pieces Subject 163444767467
  1518. XJ 600 NH 1995 Exhaust Connection Gasket 38x44x305mm 131329212846
  1519. 12V Maxtor Onetouch Ii External Hard Drive Ac 391859171685
  1520. Display Port to DVI D Adaptor DP 12 Male 301786397125
  1521. Disney CARS 3 Blind Bags Mini 651085996137
  1522. Imer Mix 60 Forced Action Screed Resin Pan 232683112399
  1523. Liverpool FC Home Kit 2016 Europa Cup Final 183594863095
Recent Torrents | March: Book One | Responder